Габариты седан калины: Габаритные размеры Лада Калина / Lada Kalina (ВАЗ 1118, 117, 1119)

Содержание

Отзыв на LADA Kalina хэтчбек I поколение

Достоинства:

Расход, габаритные размеры, управляемость, ходовая, обзорность, цена, стоимость обслуживания

Недостатки:

Внешность на любителя

В автомобиле Лада Калина Хэтчбек приходилось много ездить, поэтому хочу высказать свое мнение об автомобиле.

Первое что хотелось бы высказать что дизайн по моему мнению не очень удался, но из всех кузовов Лады Калины (седан, универсал, хэтчбек) считаю что хэтчбек самый нормальный.

Автомобильчик небольших габаритов, если сравнивать с различными другими хэтчбеками, что очень удобно в городе. Парковаться на нем удобно, обзорность в зеркала хорошая. Также несмотря на относительно небольшие габариты у автомобиля хорошая вместительность.

Перейдем к салону Калины.

В салоне просторно, спереди сидеть удобно и просторно, но вот сзади удобно может быть только вдвоем, когда садится третий становится тесновато, а если зимой в куртках так вообще как килька. Также когда водительское сиденье полностью сдвинуто назад пассажиру сзади, даже невысокого роста, не очень удобно сидеть, колени жмет. Материалы салона получше чем у приоры. Машины уже делают не сырые поэтому всё более менее подогнали, но это же российские машины.

Звукоизоляция не очень хорошая, на 60 слышно шум. Поэтому кто хочет полной тишины необходимо будет потратиться на звукоизоляцию.

Печка греет хорошо, зимой в -25 было тепло, причем и ногам и всему телу.

Сиденья удобные, не такие мягкие как в десятке, что очень хорошо. Регулировка сделана, по моему мнению, удобней чем в ВАЗ 2110.

Обзорность из салона хорошая, это очень удобно в городских условиях.

Теперь двигатель и ходовая.

Мне приходилось ездить на Ладе Калине с 16 клапанным двигателем. Надо сказать при том что машина не тяжелая она достаточно резвая с таким двигателем. А для города больше и не надо. Расход у Калины небольшой, такой же как и у приор и десток хэтчбеков новых. Работает тихо и спокойно.

Ходовая вела себя хорошо, все «неровности» наших дорог пережила достойно. Каждая трещина дороги в салон не передается, да и большие кочки смягчает.

В общем автомобиль Лада Калина достойный экземпляр. Соотношение цена-качество-обслуживание хорошее, тем более для России. Я бы советовал такой авто тем кто боится брать б/у иномарки.

Спасибо за внимание!

ВАЗ-1118 КАЛИНА седан технические характеристики

ВАЗ — 1118 — с кузовом седан и ВАЗ — 1119 — с кузовом хэтчбек.
Автомобиль может комплектоваться двигателями ВАЗ-2114, ВАЗ-2126, ВАЗ-11183.

Индекс модели 1118
Тип кузова седан
Количество дверей 4
Снаряженная масса 1080 кг.
Полная масса 1555 кг.
Дорожный просвет(клиренс) 158 мм.
Масса буксируемого прицепа с тормозами 900 кг.
без тормозов 450 кг.
Габариты ВАЗ-1118
Длина 4040 мм.
Ширина 1700 мм.
Высота 1500 мм.
Колесная база 2470 мм.
Колея передних колес 1430 мм.
Колея задних колес 1410 мм.
Размер колес 175/70R13, 175/65R14, 185/60R14
Объём багажника 400 л.
Двигатель Лада-Калина 1.6
Тип бензиновый, четырехтактный
Система питания распределенный впрыск с электронным управлением
Объём двигателя 1597 см.3
Мощность л.с/кВт 87/64 при 5100 об.мин.
Максимальный крутящий момент 140 Н*м при 3800 об.мин.
Разгон до 100 км/ч 12,2 сек.
Количество цилиндров 4
Количество клапанов 8
Диаметр цилиндра 82 мм.
Ход поршня 75,6 мм.
Степень сжатия 9,3
Марка бензина АИ-95
Трансмиссия ВАЗ-1118
Сцепление однодисковое сухое, с диафрагменной нажимной пружиной
Привод выключения сцепления троссовый, с механизмом авто регулировки длины троса
Коробка передач
Тип МКПП, 5 ступеней
Устройство с синхронизаторамина всех передачах переднего хода, с регулировкой зажнего хода
Главная передача цилиндрическая, в одном блоке с коробкой передач
Дифференциал конический, двухсателитный
Передаточные числа КПП 1-я — 3,636;
2-я — 1,357;
3-я — 1,950;
4-я — 0,941;
5-я — 0,784;
задний ход — 3,5;
Передаточное число главной передачи 3,706 или 3,937
Привод передних колес валами с шарнирами равных угловых скоростей
Ходовая часть
Передняя подвеска независимая, с телескопическими амортизоторами, винтовыми конисческими пружинами, нижними поперечными рычагами, с растяжками и стабилизатором поперечной устойчивости
Задняя подвеска полунезависимая, с телескопическими гидравлическими амортизаторами, винтовыми цилиндрическими пружинами и продольными рычагами, соединенными поперечной балкой
Колеса дисковые, стальные или легкосплавные
Рулевое управление
Рулевой механизм шестерня — рейка с электроусилителем
Рулевой привод две тяги с резинометаллическими шарнирами со стороны рулевого механизма и шарнирами со стороны поворотных рычагов
Тормозная система
Рабочая тормозная система гидравлическая, двухконтурная диагональная, с вакуумным усилителем и регулятором тормозных сил в приводе тормозных механизмов задних колес
Тормозной механизм передних колес дисковый, вентилируемый, с однопоршневой плавающей скобой и автоматической регулировкой зазора
Тормозной механизм задних колес барабанный, с самоустанавливающимися колодками и автоматической регулировкой зазора между колодками и барабаном
Стояночный тормоз ручной, с тросовым приводом на колодки тормозных механизмов задних колес
Электрооборудование
Схема однопроводная, минусовые выводы источников питания и потребителей соединены с массой кузова и силовым агрегатом
Номинальное напряжение 12 В
Аккумулятор 6СТ-55А емкость 55А/ч
Генератор — переменного тока трехфазный со встроенным выпрямительным блоком и электронным регулятором напряжения
Максимальный ток отдачи 85 А
Стартер постоянного тока, с планетарным редуктором, электромагнитным тяговым реле и муфтой свободного хода

Какой аккумулятор устанавливается на Лада Калина?

Отечественный автомобиль LADA Kalina впервые предстал на нашем рынке в 2004 году. Производился он на протяжении 14 лет, за которые не раз изменялся и модифицировался. Конечно, сходства с классической Ладой минимальные, поэтому утверждать, что она является продолжением 9-ки и тем более 6-ки, нет оснований.

Это совершенно новый концепт, он стал ближе к иномаркам. За 14 лет производства было придумано и выпущено только 2 поколения. Первое существовало на конвейере до 2013 года. Начиная с этого же года начало производиться второе, которое являлось доработанной версией первого.

Первое представление прототипов пришлось на 1999-201 гг. Автомобиль приобрел сразу 3 разновидности кузова: хэтчбэк, универсал и седан. Эта модель стала одной из первых, она была полностью спроектирована с помощью компьютерных технологий, что положительно сказалось на качестве, дизайне и комфорте.

На Лада Калина устанавливались следующие типы исключительно бензиновых двигателей:

Поколение

Объем, л

Мощность, л.с.

Класс

Маркировка

I

1.4

75

Евро-3, 4

ВАЗ-11194

 

1.6

81

Евро-2, 3, Евро-4

ВАЗ

II

1.4

87

Евро-3

ВАЗ-11186

 

1.6

98

Евро-3

ВАЗ-21126

 

1.6

106

Евро-3, 4

ВАЗ-21127

Оригинальный аккумулятор на Лада Калина

Многих интересует, какой устанавливался аккумулятор на Лада Калина. Завод изготовитель решил комплектовать свои машины отечественными батареями, популярными источниками от марки АКОМ.

Это российский бренд, который выпускает достаточно надежные и долговечные источники тока, которые соответствуют мировым требованиям по экологическим показателям и вполне способны запустить двигатель в лютые морозы.

Высокое качество и технологичность процесса их производства не могут быть оспорены, но все же их реальный срок службы составляет всего 3-4 года. Связано такое явление с самыми разными факторами, начиная от несовершенства производства, заканчивая плохими условиями эксплуатации.

Аккумулятор для лады Калины должен иметь исключительно прямую полярность, так как его клеммы расположены, наоборот, по сравнению с источниками для европейских автомобилей. На работу это никак не влияет, но при покупке нового источника обязательно необходимо учитывать, так как возникнут сложности при осуществлении монтажа на машину.

В таблице представим все параметры аккумуляторной батареи, чтобы было легче сравнивать с аналогами или альтернативными вариантами источников:

Производитель (страна)

Маркировка

Емкость, Ач

Ток холодного старта, А

Гарантия

Стоимость, р.

АОМ (Россия)

6СТ-60.1

60

520

3 года

3100

Решая купить аккумулятор на Лада Калина 2

поколения на нашем сайте, вам будет представлено 2 цены. Та, что меньше в данном случае на 700 р., может быть доступна и для вас, если вы сдадите старый АКБ нам в зачет.

Альтернативные аккумуляторные батареи

Если не знаете, на Лада Калина какой аккумулятор должен стоять, то при выборе из предложенного перечня, учтите следующие детали:

Полярность – на этом автомобиле она именно прямая. Это также можно определить по характерному вину клемм в своем авто. На батареях же отечественные производители указываю в маркировке «пп» или .1 , а зарубежные – «R+». Если вы сомневаетесь, то обязательно проконсультируйтесь с нашим специалистом.

Габариты – для LADA Kalina они должны быть следующими 242/175/190 и это обязательно, потому как другие накопители могут не уместиться, что окажется серьезной проблемой. В частности, придется вносить конструктивные изменения в кузов.

Номинал емкости и пускового тока. Первый параметр указывает на то, как долго источник сможет обеспечивать большой ток. Второй – какой величины ток она сможет выдать при температуре -18 °С. Важно, чтобы эти значения при тех же линейных размерах оказались как минимум такими же или больше. Источник с меньшей емкостью быстро будет разряжать и требовать дополнительной зарядки. Поэтому, если на Лада Калина часто горит индикатор заряда аккумулятора, то, скорее всего, до вас был установлен менее емкий, чем должен быть по паспорту. Или некачественный. Например, штатная батарея марки АКОМ способна проработать только 36 месяцев, что является весьма непродолжительным сроком. Именно поэтому мы нашли для вас как минимум 3 варианта источников, которые вполне способны заменить оригинал.

Производитель (страна)

Маркировка

Емкость, Ач

Ток холодного старта, А

Гарантия

Цена

Varta (Чехия)

Blue Dynamic D43

60

540

1 год

3300 р

Mutlu (Турция)

SFB M3 6CN-60.1

60

540

2 год

4300 р

AUTOPOWER (Чехия)

A60-L2X

60

540

3 года

5200 р

Сравнивая представленные модели аккумуляторов на Лада Калина, лучший также можно выделить. Конечно, при покупке многие скажут, зачем вы мне предлагаете дорогие батареи, тем более у двух из них даже срок гарантии меньше? На самом деле технологии производства российских и тех же чешских батарей отличаются. У западного конкурента они более прогрессивные, так как переняли их не в устаревшем виде от Германии.

Поэтому, если вдруг встанете перед вопросом, какой лучше купить, то мы посоветуем из предложенных именно чешский АКБ марки AUTOPOWER. Он дороже на 2 тыс., но по своим характеристикам он явно лучше. Конечно, если вы будете пользоваться батареей в исключительно теплом климате без внезапного перегрева, то российский также прослужит все 5 лет, но при чередовании зимнего и летнего климатов лучше установить именно этот источник. Его активная паста не высыпается, электроды не покрываются коррозией, а электролит не испаряется. В среднем, такой аккумулятор способен прослужить, по меньшей мере, 5 лет.

Бюджетные модели

Если ваш бюджет сильно ограничен или вы просто не желаете тратить много или почти много денег на аккумулятор, то мы готовы посоветовать вам также весьма неплохие батареи низкой ценовой категории. Но в них уже на 3-4 году эксплуатации велика вероятность того, что вскоре на Лада Калина будет гореть лампочка аккумулятора. Покупка такого источника будет оправдана, если автомобиль планируется в ближайшее время продать, обменять или применить в других целях, кроме самостоятельной езды.

Особенность этих батарей заключается в первую очередь именно в цене. Что касается технологии, то они явно устаревшие, но это не говорит, что вы купить абсолютно допотопную вещь. Нет, эти АКБ вполне современные, просто процесс их производства несколько более дешевый, чем при изготовлении более качественных.

Вы все думаете, какой аккумулятор для Лад Калина купить, то обратите свое внимание на следующие модели:

Производитель (страна)

Маркировка

Емкость, Ач

Ток холодного старта, А

Гарантия

Стоимость, р.

Тюмень (Россия)

Standart 6CT-60 L+

60

520

2 года

2200 р

Smart Element (Россия)

6СТ-60.1 VL3

60

480

6 месяцев

2700 р

Курский (Россия)

6СТ-60 N

60

450

1 год

2800 р

Выбирая из представленных в перечне аккумуляторов, также можно выделить лучший из них. К таким смело стоит отнести Курский. Этот источник изготовлен по новейшим технологиям, они позволяют добиться высоких показателей емкости, но учтите пусковой ток при холодном старте. Экономя не так уже и много денег по отношению с оригинальной батареей, вы получите менее мощный источник, который, возможно при первом морозе уменьшит свою емкость. Такое обычно происходит при неправильной эксплуатации и недолжном уходе.

Если все равно после замены на Лада Калина загорается индикатор аккумулятора, то, скорее всего, у вас проблема в электрике. Вам ее устранят специалисты из нашего партнерского автоцентра быстро и качественно. Диагностику батареи на Ладе Калине мы проводим самостоятельно в любом из наших магазинов, услуга диагностики бесплатная.

Видео установки аккумулятора на Лада Калина

 

Сохраните эту статью в популярных соц. сетях:

 

размеров Chevrolet Cruze. Какие габариты кузова Шевроле Круз? Chevrolet Cruze Седан

Основные габариты и масса автомобиля Седан Люк 5-dr SW
Длина, мм 4597 4510 4675
Ширина без учета зеркал, мм 1788 1797 1797
Высота, мм 1477 1477 1521
Колесная база, мм 2685 2685 2685
Ширина колеи передняя / задняя, ​​мм 1544/1558 1544/1558 1544/1558
Мин. Радиус поворота, м 5.45 5,45 5,45
Объем багажного отделения, л 450 413/883 500/1478
Высота над передним / задним сиденьями, мм 999/963 999/974 999/988
Ширина салона на уровне плеч передних / задних пассажиров, мм 1391/1370 1391/1370 1391/1370
Пространство для ног передних / задних пассажиров, мм 1074/917 1074/917 1074/917
Объем топливного бака, л 60 60 60
Максимально допустимая масса, кг 1788 1818 1899
Размер обода колеса 6.5Jx16 6.5Jx16 6.5Jx16
Размер шин 205/60 R16 205/60 R16 205/60 R16
Двигатели и трансмиссия 1,6
МТ (АКПП)
1,8
МТ (АКПП)
1,6
МТ (АКПП)
1,8
MT (AT)
1,6 MT 1,8
МТ (АКПП)
Тип двигателя бензин бензин бензин бензин бензин бензин
Объем двигателя, см3 1598 1796 1598 1796 1598 1796
Цилиндры 4 4 4 4 4 4
Максимальная мощность, кВт / ч.п. 80/109 104/141 80/109 104/141 91,2 / 124 104/141
Максимальный крутящий момент, Нм / об / мин 150/4000 176/3800 150/4000 176/3800 154/4200 176/3800
Трансмиссия 5-ступенчатая механическая (6-ступенчатая автоматическая) 5-ступенчатая механическая (6-ступенчатая автоматическая) 5-ступенчатая механическая (6-ступенчатая автоматическая) 5-ступенчатая механическая (6-ступенчатая) автомат) 5-МКПП (6-АКПП) 5-МКПП (6-АКПП)
Ходовые качества
Максимальная скорость, км / ч 185 (177) 200 (190) 185 (177) 200 (195) 192 206 (200)
Время разгона 0-100 км / ч, с 12.5 (13,5) 11 (11,5) 12,5 (13,5) 10,1 (10,4) 12,6 11 (11,5)
Расход топлива (смешанный цикл), л на 100 км. 7,3 (8,3) 7,8 (6,8) 7,3 (8,3) 6,6 (7,4) 6,5 6,7 (7,1)
Выбросы СО2, г / км 172 (198) 159 (184) 172 (178) 155 (174) 153 158 (170)

Отзыв покупателя.
Белков Михаил:

Выражаю благодарность мастеру Андрею Шанкову за качественное обслуживание ТО-1 шевроле -…

Выражаю благодарность мастеру Андрею Шанкову за качественное обслуживание ТО-1 автомобиля шевроле — орландо.

Отзыв покупателя.
Юрий Турубаров:

Делал недавно в Автоцентре Сити Видное регулярное обслуживание + замена задних тормозных колодок. Все понравилось …

Делал недавно в Автоцентре Сити Видное регулярное обслуживание + замена задних тормозных колодок.Все понравилось. Сам он присутствовал в технической зоне и наблюдал за работой. Все сделано качественно и профессионально, придраться не к чему.
Хочу поблагодарить автомеханика Максима и главного инспектора Алексея Гагарина.

Отзыв покупателя.
Ольга Евстратова:

Хочу выразить благодарность всему коллективу вашей компании за качественный сервис …

Хочу выразить благодарность всему коллективу вашей компании за качественное обслуживание при покупке автомобиля.Особая благодарность Елене Ивашкиной, Вячеславу и Дмитрию.

Отзыв покупателя.
Лыткин Д.И .:

я хотел бл …

Уважаемое руководство ООО «Автоцентр Сити» и ОСАО «Ингострах».

Хочу поблагодарить вас и ваших сотрудников за такую ​​тяжелую работу, которую вы проделали, чтобы предложить мне лучшее и наиболее выгодное предложение по полису ОСАГО и КАСКО. Мало того, что вы выполнили работу в срок, продажа полиса ОСАГО и КАСКО на 2014-2015 годы была сделана для меня профессионально и в полном объеме, что соответствует моим потребностям на данный момент в страховой службе.
Вы проделали отличную работу и заслуживаете высшей похвалы.

Сообщаем Вам, что сотрудники отдела страхования ООО «Автоцентр Сити», а именно Елена Герасимова (начальник отдела страхования и кредитования), Матвеева Людмила (специалист по страхованию и кредитованию), Климова Зореслава (старший специалист по страхованию и кредитованию) ) — отлично справляются с работой в сфере страхования и работы с клиентами, всегда отзывчивы и готовы помочь, предоставить подробную информацию обо всей продуктовой линейке, уделять максимум внимания каждому клиенту, всегда приветливы и решать поставленные перед ними задачи.
Сотрудники горячей линии ООО «Автоцентр Сити» и ОСАО «Ингострах» всегда оперативно и качественно отвечают на все вопросы, хочу поблагодарить претензионный отдел компании за оперативные ответы и детальный анализ любой ситуации.

Я знаю, что вы уделяете дополнительное время качественному и полноценному выполнению работы, и ценю все, что вы делаете, чтобы помочь каждому клиенту, вы перспективные, талантливые и целеустремленные сотрудники в своей области.

Я действительно рад видеть вас и вашу команду в качестве моей страховой компании.

Шагая к успеху с ООО «Автоцентр Сити» и ОАО «Ингострах»!

С уважением, Лыткин Денис Игоревич

Отзыв покупателя.
Дмитрий Куликов:

Выражаю благодарность отделу запчастей за консультации по зимним шинам и расходным материалам …

Выражаю благодарность отделу запчастей за предоставленные советы по зимней резине и расходным материалам.
Большое спасибо Анне! Получены ответы на все интересующие вопросы.

Отзыв покупателя.
Негода Руслан:

Неделю назад купил машину Опель Астра. Хочу поблагодарить Георгиевского Максима за его …

Неделю назад купил машину Опель Астра. Хочу поблагодарить Георгиевского Максима за профессионализм. Максим дал полную информацию об автомобиле, о действующих скидках. Короче отличный менеджер, обращайтесь к нему всем!

Отзыв покупателя.
Александр Иванушкин:

Добрый день!
Выражаю огромную благодарность Александре Сучковой за отзывчивость и…

Добрый день!
Выражаю огромную благодарность Александре Сучковой за отзывчивость и понимание моей жизненной ситуации. Александра нашла возможность и нашла окно, чтобы поставить нашу машину в ремонт до 11 июня 2013 года.
Ситуация такова: у нас очень больной ребенок семи лет (детский церебральный паралич), 11 июня нам надо ехать. с ним в город Ярославль, потом обратно в Москву, и кондиционер перестал работать, для ребенка это очень тяжелая поездка, и даже без кондиционера нельзя открыть окна, простудиться.Александра не защищалась официальной формой, она проявила поистине эмоциональную заботу. В итоге 6 июня все неисправности отремонтировали, и я с благодарностью покинул ваш Центр города.
Также хочу выразить благодарность мастеру, получателю, к сожалению, не знаю его фамилии. Отличный специалист, внимательный и внимательный.
БОЛЬШОЕ СПАСИБО, ГОСПОДЬ СПАСИТ ВАС!
С уважением, Иванушкин Александр Сергеевич
Л / Н В571СА197

Отзыв покупателя.
Сергеев Александр Иванович:

Я ваш постоянный клиент. Решил купить другую машину — Опель Анатару. Осталось …

Я ваш постоянный клиент. Решил купить другую машину — Опель Анатару. Остался очень доволен правильным сервисом и отношением к клиентам. Все очень понравилось, в будущем буду рекомендовать друзьям и знакомым. Особо благодарен моему менеджеру Данилевскому Ярославу. Всем спасибо и с наступающим Новым годом! Успешных продаж.

Отзыв покупателя.
Иван:

Хочу выразить огромную благодарность за отличную работу Николаю Мальцеву! Сделали отличную скидку и забрали машину …

Хочу выразить огромную благодарность за прекрасную работу Николаю Мальцеву! Сделал отличную скидку и забрал машину, которую хотел! Большое ему спасибо!

Отзыв покупателя.
Шаповалов Владимир:

Хочу искренне поблагодарить Ивана Москвина за подход, внимание и понимание.Было бы еще ре …

Хочу искренне поблагодарить Ивана Москвина за подход, внимание и понимание. Таких ребят было бы больше. Большое ему спасибо!

Отзыв покупателя.
Игорь Григорьев:

Выражаю благодарность специалистам по оформлению страховых случаев Антону Диаглеву и Колоянову …

Хочу выразить благодарность специалистам по оформлению страховых случаев, Антону Дяглеву и Ирине Колояновой за хорошую работу.

Отзыв покупателя.
Есина Екатерина:

Я очень доволен покупкой своей машины. На удивление все было сделано очень быстро — с момента выбора …

Я очень доволен покупкой своей машины. На удивление все было сделано очень быстро — с момента забора машины до момента выдачи. Мне понравилось, что они выбрали нужный мне цвет: сначала заказали белый, потом поменяли на синий. Отдельное спасибо Ярославу Данилевскому! Надеюсь, что немецкая сборка моего Опель Корса меня никогда не подведет.Еще раз спасибо за то, что были там!

Отзыв покупателя.
Алексей Мещанинов:

Проехали мимо и решили позвонить в ваш автосалон. Нам предложили очень выгодный вариант, из которого …

Проехали мимо и решили позвонить в ваш автосалон. Нам предложили очень выгодный вариант, от которого мы не смогли отказаться. Подобрали нужную нам машину. В кратчайшие сроки мы получили новую машину и сдали старую по trade-in. Остались очень довольны работой автосалона.Отдельное спасибо Ярославу Данилевскому за оперативную работу!

Отзыв покупателя.
Зайцев Иосиф Михайлович:

Свой салон выбрал, т.к. Вы меня постоянно обслуживаете. При покупке новой машины понравилось как …

Свой салон выбрал, т.к. Вы меня постоянно обслуживаете. При покупке новой машины мне понравилось, как быстро и быстро меня обслужили. Получила ответы на все свои вопросы, подобрала нужную мне машину. Остался очень доволен высоким сервисом. Мне очень понравился ведущий менеджер Ярослав Данилевский.Уверен, что в будущем буду покупать только у вас новую машину!

Габариты Chevrolet Cruze , объем его багажника и клиренс (клиренс) интересуют всех потенциальных покупателей этого замечательного автомобиля. В сегодняшней статье мы подробно разберем габариты багажника, габариты и клиренс Шевроле Круз .

Сразу скажем, что сегодня Круз продается в России в трех вариантах кузова. Это седан, хэтчбек и круиз Cruze в универсальном кузове.Длина у всех автомобилей разная, но колёсная база и дорожный просвет одинаковы. Салон одинаково просторен во всех трех вариантах, но размер багажника существенно различается.

Дорожный просвет Chevrolet Cruze — один из важнейших факторов при эксплуатации автомобиля на неровных дорогах. Сам производитель заявляет, что клиренс Cruze составляет 16 сантиметров, но как показывает замер под защитой моторного отсека, этот показатель составляет около 140 мм.Стоит учитывать размер колес и высоту профиля покрышек, которые устанавливаются на автомобили, от этого клиренс Круза может измениться. Сам производитель предлагает в качестве стандартных колес установить 205/60 R16 или 215/50 R17.

Начнем обзор габаритов с седана Cruise. Длина автомобиля — 4597 мм. колесная база 2 685 мм, объем багажника Шевроле Круз 450 литров … Объем багажного отделения невелик, так как конструкторы дали больше места пассажирам.Подробные размеры седана чуть ниже.

Размеры, клиренс багажника Шевроле Круз седан

  • Длина — 4597 мм
  • Ширина — 1788 мм
  • Высота — 1477 мм
  • Масса снаряженная — от 1285 кг
  • Полная масса — 1788 кг
  • Объем багажника — 450 литров
  • Дорожный просвет седана Шевроле Круз 160 мм

Длина хэтчбека почти на 9 сантиметров меньше, чем у седана Cruz, объем багажника — 413 литров, что заметно меньше, чем у такого же седана.Однако у хэтчбека Cruze есть большое преимущество, это дверь багажника, в которую при сложенных сиденьях можно загрузить практически все, чем седан не может похвастаться. Подробная информация о размерах машины ниже.

Размеры, клиренс багажника Шевроле Круз хэтчбек

  • Длина — 4510 мм
  • Ширина — 1788 мм
  • Высота — 1477 мм
  • Снаряженная масса — от 1305 кг
  • Полная масса — 1818 кг
  • База, расстояние между передней и задней осью — 2685 мм
  • Колея передних и задних колес 1544/1558 мм соответственно
  • Объем багажника — 413 литров
  • Объем топливного бака — 60 литров
  • Размер шин — 205/60 R16, 215/50 R17
  • Дорожный просвет Шевроле Круз хэтчбек — 160 мм

Размеры, клиренс багажника Шевроле Круз универсал

  • Длина — 4675 мм
  • Ширина — 1797 мм
  • Высота с рейлингами — 1521 мм
  • Масса снаряженная — от 1360 кг
  • Полная масса — 1899 кг
  • База, расстояние между передней и задней осью — 2685 мм
  • Колея передних и задних колес 1544/1558 мм соответственно
  • Объем багажника универсала Шевроле Круз — 500 литров
  • Объем багажника при сложенных задних сиденьях — 1478 литров
  • Объем топливного бака — 60 литров
  • Размер шин — 205/60 R16, 215/50 R17
  • Дорожный просвет Шевроле Круз универсал — 160 мм

Универсал Chevrolet Cruze имеет самый большой багажник, самый длинный во всем семействе Cruze.Это самая практичная машина. Разница в длине между люком и универсалом более 16 сантиметров, в пользу SW. Объем багажного отделения составляет ровно 500 литров, но следует учитывать, что это показатель, только до полки, при загрузке до потолка показатель значительно увеличится. Но если сложить задние сиденья, то мы получим почти полторы тысячи литров объема для перевозки грузов.

Chevrolet Cruze — седан корейского концерна General Motors.Этот компактный городской автомобиль C-класса пришел на смену моделям Cobalt и Lacetti. Модель разрабатывалась GM в течение 21 месяца, за это время на постройку автомобиля было потрачено более 4 миллиардов долларов. В Южной Корее автомобиль был впервые представлен в октябре 2008 года как Daewoo Lacetti Premiere, а в Австралии он продается как Holden Cruze. Chevrolet Cruze начал продаваться на российском рынке осенью 2009 года. Производство модели осуществляется в Южной Корее, для российского рынка — в Шушарах (Санкт-Петербург).-Петербург), а для Америки — в США, штат Огайо. Chevrolet Cruze построен на платформе Delta II, которая также используется в Opel Astra. Кузов Chevrolet Cruze на 65 процентов изготовлен из высокопрочной стали. Колесная база автомобиля составляет 2685 мм, длина — 4597 мм., Ширина — 1788 мм. высота — 1477 мм. Дорожный просвет составляет 140 миллиметров.

Автомобиль создавался под руководством Тэвана Кима, который разработал такие популярные модели, как Matiz, Aveo, Chevrolet Epica. Изогнутая линия крыши, начинающаяся от высокого лобового стекла, плавно спускается к стойкам С и укороченной задней части, придавая пропорциям седана вид купе.Спереди бросаются в глаза большие корпуса фар, которые охватывают передние углы и устремляются к крыльям и скульптурному капоту. Среди других отличительных особенностей дизайна — двухъярусная решетка радиатора и выступающие колеса.

Уютный салон рассчитан на пятерых пассажиров. Дизайн салона полностью соответствует модным тенденциям: тканевые вставки, soft-touch пластик, отличный эргономичный дизайн руля, стильный дизайн приборной панели. Рулевое колесо и водительское сиденье имеют один из самых широких диапазонов регулировок в своем классе, что позволит даже высоким владельцам чувствовать себя за рулем комфортно.Кожаная обивка и сиденья с подогревом доступны в качестве опции. Комфорт для пассажиров и водителя также обеспечивают: электрические стеклоподъемники, кондиционер, проигрыватель компакт-дисков, подогрев боковых стекол и многое другое.

Базовая модель имеет на борту передние, боковые и потолочные подушки безопасности ABS, ESP и TSC. Кроме того, в этот пакет входят сервопривод, противоугонная сигнализация, магнитола и CD-проигрыватель, электрические стеклоподъемники, регулируемые по высоте сиденья водителя и переднего пассажира.

Несмотря на небольшой свес, багажник Chevrolet Cruze имеет объем 450 литров и увеличен за счет складывающихся спинок задних сидений, а под ковриком багажника расположена полноразмерная запаска.

На момент старта продаж автомобиль предлагался с 16-клапанным бензиновым двигателем 1,6 л (109 л.с.) и с бензиновым двигателем 1,8 л (141 л.с.), которые отличаются изменяемым временем открытия клапана, как при впуске. и в фазе выхлопа. … Это увеличивает мощность, а также оптимизирует расход топлива и снижает токсичность. Примечательно, что для корейского рынка автомобиль комплектуется более мощным, но требовательным к качеству топлива двигателем 1,6 л / 124 л.с. Линейка дизелей представлена ​​цифрой 2.0-литровый турбодизель мощностью 150 л.с. и 320 Нм крутящего момента. В 2009 году линейку моторов пополнили 1,4-литровый бензиновый двигатель с турбонаддувом мощностью 138 л.с. Силовые установки агрегатируются с двумя коробками передач на выбор: 5-дневная механика и 6-ступенчатая адаптивная автоматическая трансмиссия. В России Chevrolet Cruze доступен только с двумя бензиновыми двигателями 1,6 / 109 л.с. и 1,8 л / 141 л.

Стальной каркас автомобиля, шесть подушек безопасности и система стабилизации делают седан Cruze одним из самых устойчивых и безопасных автомобилей.В краш-тестах EuroNCAP автомобиль получил максимум 5 звезд за безопасность. Электронная система стабилизации Chevrolet Cruze дает возможность временно приостановить любое колесо, помогая водителю уверенно удерживать автомобиль на дороге в любую погоду. Передняя подвеска — Макферсон с алюминиевыми А-образными рычагами и гидравлическими опорами (вместо резиновых втулок), задняя подвеска — подвижная двутавровая балка с парой рессор.

Спустя несколько лет к седану добавился 5-дверный хэтчбек.Серийная версия хэтчбека Chevrolet Cruze 2012 года была представлена ​​GM на Женевском автосалоне 2011 года. С его введением GM рассчитывает значительно увеличить количество продаж своих автомобилей класса C. Хэтчбек оказался быстрее и спортивнее седана благодаря форме крыши и отсутствию выступающего багажника сзади. Новая форма кузова потребовала уменьшить объем полезного пространства багажника, оставив в сумме 413 литров объема, если сложить спинки задних сидений, объем равен 883 литрам.

Интерьер хэтчбека окружает пассажиров одновременно теплой и спортивной атмосферой. Он состоит из гладких, гармоничных линий и приятных на ощупь зернистых материалов. По европейским требованиям безопасности EuroNCAP хэтчбек Chevrolet Cruze, как и седан, получил пять звезд.

Chevrolet Cruze — 5-дверный автомобиль C-класса, который отличается практичностью и универсальностью. Эта модель подойдет как начинающим автомобилистам, так и опытным водителям вне зависимости от режима эксплуатации — версия хэтчбек отлично впишется в городской поток или бездорожье.

Chevrolet Cruze: виды и модификации версии хэтчбека

За свою историю автомобиль выпускался в двух поколениях: первая версия была разработана для старшей мужской категории как практичный, но экономичный автомобиль, вторая — как стильный автомобиль с динамичными техническими характеристиками для молодежи. Различия в генезисе заключаются в форм-факторе кузова и типах двигателей, и каждая версия хэтчбека выпускалась как с традиционной механической коробкой передач, так и с автоматом 2WD.

Модель / комплектация Объем двигателя, л Мощность, л с Тип коробки передач Привод Разгон до 100 км / ч, с Макс. скорость, км / ч Расход топлива, л
(город / пригород /
смешанный)
MT LT, MT LS 137 Механика, 6-ти ступка Передняя 8,3 190 8,1 / 7,7 / 7,4
А Т ЛТЗ, АТ ЛТ, АТ ЛС 1.4 Ecotec с турбонагнетателем 137 Передний 8,4 185 8,1 / 7,7 / 7,4
MT LT, MT LS 1,6 Ecotec 109 Механика, 5-ти ступка Передняя 8,2 185 8,6 / 8,0 / 7,6
AT LT, AT LS 1,6 Ecotec 109 Гидротрансформатор, 2WD, 6 ступка Передний 8,2 177 8.3 / 8,0 / 7,5
MT LT, MT LS 1,8 Ecotec 141 Механика, 6-ти ступка Передняя 8,3 200 10,1 / 9,0 / 8,2
AT LT, AT LS 1,8 Ecotec 141 Гидротрансформатор, 2WD, ступка Передний 8,3 200 10,0 / 9,0 / 8,2
MT LT, MT LS 2.0 Ecotec 161 Механика, 5-ти ступка Передняя 8.0 210 9,9 / 9,4 / 9,0
AT LTZ, AT LT, AT LS 2.0 Ecotec 161 Гидротрансформатор, 2WD, 6-ступка Передний 8,0 206 9,8 / 9,4 / 8,9

ВНИМАНИЕ! Нашел совершенно простой способ снизить расход топлива! Не верите мне? Автомеханик с 15-летним стажем тоже не верил, пока не попробовал. А теперь на бензине экономит 35000 рублей в год!

За недолгую историю эксплуатации молодежная версия Chevrolet Cruze претерпела множество тюнинговых доработок и рестайлинга — основным направлением модернизации автомобиля был форсированный двигатель, а также изменение конструкции кузова и его узлов в стиль Лексус или Мерседес.

Технические характеристики автомобиля

Особенностью модели Chevrolet Cruze является широкий диапазон двигателей, включая версии на бензине и дизельном топливе. При одинаковых габаритах кузова и разной степени технического оснащения возможно изменение мощности автомобиля без изменения модельного ряда автомобиля.

Модель / комплектация Габаритные размеры, мм Масса, кг
1,4 MT LT, AT LT 4510 x 1797 x 1477 1305
1.6 MT LS 4510 x 1797 x 1477 1305
1,6 MT LS A / C 4510 x 1797 x 1477 1305
1,8 MT LT 4510 x 1797 x 1477 1310
1,8 AT LT 4510 x 1797 x 1477 1310
1,8 MT LS 4510 x 1797 x 1477 1310
1,6 AT LT 4510 x 1797 x 1477 1315
1.6 AT LS 4510 x 1797 x 1477 1315
1,8 AT LTZ 4510 x 1797 x 1477 1319
1,8 AT LT 4510 x 1797 x 1477 1319
1,4 т AT LTZ 4510 x 1797 x 1477 1404

Chevrolet Cruze — динамичный автомобиль с маневренностью и плавным прохождением поворотов. У машины сбалансированный центр тяжести и рациональное распределение крутящего момента, что увеличивает устойчивость автомобиля и увеличивает прижимную силу.Компактные размеры кузова и обтекаемый кузов усиливают тягу и равномерно распределяют потоки воздуха — Chevrolet Cruze не испытывает перегрузок и признаков раскачивания даже на высоких скоростях.

Chevrolet Cruze вне зависимости от типа двигателя и размера кузова комбинируется в различных комплектациях со следующими параметрами:

  1. Тип привода передний;
  2. Клиренс 156 мм;
  3. Объем бака — 60 л;
  4. Диски — 5Jx16;
  5. Шины — 205/60 R16;
  6. Колесная база — 2685 мм;
  7. Багажник объемом 413 литров и 5 пассажирских мест;
  8. Пространство для ног передних / задних пассажиров 1074/917 мм.

Это интересно! Благодаря большому разнообразию двигателей, а также альтернативной конфигурации коробок передач Chevrolet Cruze стал популярным автомобилем среди всех слоев населения. Возможность подобрать технический потенциал автомобиля под свои предпочтения или стиль вождения обеспечила мощный скачок продаж автомобилей на рынках Европы, Америки и России при запуске производства автомобилей — каждый 5-й клиент салона Chevrolet выбрал Cruise.

Цена вторичного рынка: сколько продать?

Свежий Chevrolet Cruze на 109 лошадей и механики, а также в минимальной комплектации стоит около полумиллиона рублей, на более мощные версии и функциональность цена увеличивается вдвое.
Chevrolet Cruze — надежный автомобиль, легко выдерживающий динамическую эксплуатацию и не требующий особых вложений на первые 2–3 тысячи пройденных километров, что обеспечивает фиксацию цен на вторичном рынке.При выборе подержанного Cruise водители чаще обращают внимание на состояние расходных материалов и внешний вид автомобиля, чем на технические компоненты, а значит, косметический ремонт увеличит стоимость автомобиля.

Выгодно ли покупать подержанный хэтчбек Chevrolet Cruze?

Подержанный Chevrolet Cruze с экономической точки зрения является оптимальным транспортным средством с точки зрения соотношения цены и качества. Автомобиль имеет привлекательный внешний вид и практичный дизайн, которые вкупе с высоким эксплуатационным ресурсом и техническими характеристиками выгодно выделяют Cruise среди других представителей класса С в лучшую сторону.
Качество сборки и оснащения всех моделей в несколько раз выше показателей отечественного автопрома и лишь незначительно уступает флагманам японской и немецкой техники.

Стоит знать! Cruze с АКПП на дизельном топливе — наиболее экономичный вариант для езды в плотном потоке: умеренный аппетит автомобиля с высокой маневренностью и тяговитостью значительно снизит затраты на топливо без потери транспортной динамики.Если вы хотите водить механика, рекомендуется выбрать модель с объемом двигателя 1,8 литра на бензине и установить европейское газовое оборудование — конструкция двигателя и объем багажника предполагают возможность такого апгрейда.

Распространенные болезни Шевроле Круз: на что обращать внимание при покупке?

Покрытие кузова — оцинкованный металл обладает высокой прочностью и устойчивостью к коррозии, однако при распылении краски быстро покрываются сколы и трещины при движении по грунтовым дорогам или хранении без гаража.

Кнопка открывания багажника выходит из строя при резких перепадах температуры или хранении в неотапливаемом помещении зимой. Неработающая кнопка приводит к разрядке даже новых батарей, постепенно ухудшая их свойства.

Ремень ГРМ является потенциально опасной деталью. Ресурс ремня около 60 000 км, после чего его нужно заменить, иначе разрыв детали чреват погнутыми клапанами двигателя, что будет в копеечку. Также во время замены не затягивайте ремень слишком сильно, чтобы избежать преждевременного разрыва.

При интенсивной эксплуатации проблемы с МКПП могут появиться в районе 70-80 000 км при переключении с первой на вторую передачу. Это связано с выходом из строя диска сцепления, из-за нарушения целостности конструкции пружины амортизатора — данный отказ считается заводским просчетом и может вызвать необходимость ремонта КПП при перегрузке насыпи.

Приобретая автомобиль с автоматической коробкой передач, не стесняйтесь протестировать коробку передач: гидромеханика Круз надежная система, однако при пробеге 150-200 000 км возможны провалы при переключении на высшие передачи.Эта проблема возникает в результате износа каналов в корпусе клапана, что повлечет за собой дорогостоящий ремонт.

Chevrolet Cruze — надежный автомобиль, который при бережной эксплуатации может без капитального ремонта выдержать до 300 000 км пробега, но при покупке подержанного автомобиля следует провести полную диагностику всех систем автомобиля.

Chevrolet Cruze седан C-сегмент, о котором мы сегодня поговорим, — очень удачный автомобиль. Мы расскажем подробнее об истории его создания.Также вас ждут Шевроле Круз технические характеристики, фото и видео, а также актуальные цены и комплектации автомобилей в России. Прежде всего, это тест-драйва Chevrolet Cruze .

Американский концерн General Motors решил создать глобальную модель как для развивающихся рынков, так и для рынка коренных американцев. При разработке использовалась платформа GM Delta II, на ней также базируется Opel Astra J. Презентация седана Chevrolet Cruze состоялась в 2008 году в Корее, где автомобиль получил название Daewoo Lacetti Premiere.Собственно, сегодня основная часть автомобилей производится в Корее на заводе Daewoo в городе Инчхон. Шевроле Круз также производится в России в Ленинградской области в Шушарах, еще один сборочный завод находится в Казахстане.

В Австралии автомобиль имеет правый руль и зовется Holden Cruze. В США автомобиль был представлен как замена американскому Chevrolet Cobalt, кстати, в США Cruise занимает лидирующие позиции в классе компактных автомобилей на местном рынке.В Санкт-Петербурге сборка стартовала в 2009 году, осенью того же года начались продажи седана Chevrolet Cruze. В конце 2011 года началась сборка версии хэтчбека Шевроле Круз, подробный обзор которой есть на нашем сайте. Универсал Chevrolet Cruze впервые был показан в марте 2012 года; Версия SW также продается в России.

Сейчас появилась информация, что готовится новая версия купе Chevrolet Cruze. Дэвид Лайон отвечает за дизайн всего проекта Cruze.Кстати, автомобиль уже прошел незначительный рестайлинг. Новый Cruz можно узнать в первую очередь по переднему бамперу с измененной формой противотуманных фар. Фактический внешний вид машины получился очень впечатляющим, благодаря чему машина внешне выглядит больше, чем есть на самом деле. Предлагаем вашему вниманию фото Шевроле Круз седан … Предлагаем также фото интерьера Шевроле Круз седан … Экстерьер и интерьер автомобиля очень выразительны, его невозможно спутать с другими моделями.В том же стиле и на той же платформе создан минивэн Chevrolet Orlando.

Фото салона Шевроле Круз седан

Технические характеристики Шевроле Круз седан

Шевроле Круз технические характеристики очень интересны. Например, для разных рынков предлагаются самые разные силовые агрегаты, это бензиновые Ecotec с рабочим объемом 1,4 (плюс 1,4 турбо), 1.6 (плюс 1,6 турбо), 1,8 л. Кроме того, есть два дизеля рабочим объемом 2 литра. Совсем недавно в России появился Шевроле Круз турбо … Переднеприводный Круз может иметь как 5-ступенчатую механику, так и 6-ступенчатый автомат. На некоторых рынках также предлагается 6-ступенчатая механика в комплекте с 2-литровым дизельным двигателем.

Дорожный просвет или клиренс в России составляет 16 сантиметров, но на других рынках он составляет 14 сантиметров. Однако эта цифра условна из-за использования разных колесных дисков и шин.Огромные колесные арки позволяют устанавливать довольно большие колеса. То есть, если вместо R16 поставить колеса R17, то клиренс будет немного выше.

Что касается багажника седана Круз, то его объем немного, всего 450 литров. Собственно, салон решил выделить больше места, и это правильно. Например, у Lada Granta большой багажник на 520 литров, но при этом салон очень тесноват, особенно сзади. Американцы любят просторные автомобили, поэтому решили подарить багажное отделение.Если хотите большой багажник, купите универсал Cruze SW. Ниже предлагаем подробные характеристики круизного седана .

Размеры, масса, объемы, клиренс Шевроле Круз седан

  • Длина — 4597 мм
  • Ширина — 1788 мм
  • Высота — 1477 мм
  • Масса снаряженная — от 1285 кг
  • Полная масса — 1788 кг
  • База, расстояние между передней и задней осью — 2685 мм
  • Колея передних и задних колес 1544/1558 мм соответственно
  • Объем багажника — 450 литров
  • Объем топливного бака — 60 литров
  • Размер шин — 205/60 R16, 215/50 R17
  • Дорожный просвет седана Шевроле Круз 160 мм

Характеристики Ecotec 1.6 литровый двигатель

  • Рабочий объем — 1598 см3
  • Мощность — 109 л.с. при 6000 об / мин
  • Крутящий момент — 150 Нм при 4000 об / мин
  • Максимальная скорость — 185 (МКПП) и 177 (АКПП) километров в час
  • Время разгона до первой сотни — 12,5 (МКПП) и 13,5 (АКПП) секунд
  • Расход топлива в смешанном цикле — 7,3 (МКПП) и 8,3 (АКПП) литра

Ecotec 1.Технические характеристики 8-литрового двигателя

  • Рабочий объем — 1796 см3
  • Мощность — 141 л.с. при 6000 об / мин
  • Крутящий момент — 176 Нм при 3800 об / мин
  • Максимальная скорость — 200 (МКПП) и 190 (АКПП) километров в час
  • Время разгона до первой сотни — 11 (МКПП) и 11,5 (АКПП) секунд
  • Расход топлива в смешанном цикле — 6,8 (МКПП) и 7,8 (АКПП) литра

Ecotec 1.4 Технические характеристики двигателя с турбонаддувом

  • Рабочий объем — 1398 см3
  • Мощность — 140 л.с. при 4900 об / мин
  • Крутящий момент — 200 Нм при 1850 об / мин
  • Максимальная скорость — 200 (АКПП) километров в час
  • Время разгона до первой сотни — 10,3 (АКПП) секунды
  • Расход топлива смешанный — 5,7 (АКПП) литра

Сразу отметим, что если Chevrolet Cruze Sedan 1.6 и 1.Доступно 8 бензиновых двигателей как с механикой, так и с автоматической коробкой передач, тогда новый 1,4-литровый турбомотор доступен только с автоматической коробкой передач.

Цены и комплектации Шевроле Круз седан

Cruze имеет три основных уровня отделки салона: базовый LS, средний LT и топовый LTZ. В начальной версии LS Chevrolet Cruze sedan уже есть кондиционер с воздушным фильтром, 4 подушки безопасности и магнитола с 6 динамиками.Полноразмерная запаска, стальные диски R 16. Передние стеклоподъемники и АБС. Цена такой комплектации чуть более 650 тысяч рублей.

IN среднего класса Cruise LT добавлены следующие опции. Уже 6 подушек безопасности, все 4 стеклоподъемника, рулевое управление стерео, центральный подлокотник, противотуманные фары. За дополнительные 30 тысяч рублей предлагается пакет опций, в который входит мультимедийная система Mylink (Радио, USB, Bluetooth, цветной дисплей в центральной консоли), задний парктроник, климат-контроль вместо кондиционера, плюс сплав R 16 колеса.

IN топовая версия LTZ седан Chevrolet Cruze имеет климат-контроль, круиз-контроль, 17-дюймовые легкосплавные диски, электрические складывающиеся зеркала, мультимедийную систему MyLink и массу других опций. Цена такой комплектации — почти 900 тысяч рублей. Точные и текущие цены на 2014 год немного ниже.

  • Chevrolet Cruze LS 1.6 MT — 651000 рублей
  • Chevrolet Cruze LS 1.6 AT — 722000 рублей
  • Chevrolet Cruze LS 1.8 MT — 726000 рублей
  • Шевроле Круз ЛТ 1.6 МТ — 725 000 руб.
  • Chevrolet Cruze LT 1.6 AT — 762000 рублей
  • Chevrolet Cruze LT 1.8 MT — 766000 рублей
  • Chevrolet Cruze LT 1.8 AT — 803000 рублей
  • Chevrolet Cruze LTZ 1.4 Turbo AT — 885000 рублей

Топовая версия Chevrolet Cruze LTZ доступна только с 6-диапазонным автоматом и 1,4-литровым турбомотором. Два других уровня отделки салона можно комбинировать с двигателями 1,6 и 1,8 литра, а также возможностью выбора трансмиссии.

Видео краш-теста Chevrolet Cruze от европейской ассоциации Euro NCAP. Тест на безопасность показал 5 звезд, сам производитель указывает, что при создании кузова серьезно проработали силовой каркас. Машину готовили к американскому краш-тесту, более суровому, чем европейский.

Тест-драйв седана Chevrolet Cruze. Вполне объективный отзыв о седане.

Главный конкурент Chevrolet Cruze — Ford Focus.Сравнивать их непросто, хотя в сети уже появилось несколько видеороликов сравнительных испытаний машин. В 2013 году в России было продано 54 367 автомобилей Chevrolet Cruze и 67 142 Ford Focus, поэтому в прошлом году победил Focus, посмотрим, что будет в этом году.

Сравнение

доступных хэтчбеков. Сравнение салонов Датсун Ми-До и Лада Калина

Сравнивая между собой Datsun mi-DO и Lada Kalina, автомобилисты сталкиваются с непростым вопросом: «Какой хэтчбек лучше?» Ведь на самом деле одна из машин легко может превосходить другую по некоторым параметрам, но заметно уступать по остальным.Например, отечественная Lada превосходит Datsun по практичности и более мощным силовым агрегатам, но уступает ему по оснащению и стилю.

Выбор между МИ-ДО и Калиной осложняется тем, что автомобили имеют примерно одинаковую ценовую категорию.

Lada уступает место по престижности Datsun

Не стоит думать, что японец по популярности превосходит отечественного представителя. Обе машины собираются с одинаковой скоростью и сходят с конвейера на одном заводе.Но психология российского потребителя построена несколько иначе и при выборе авто тяготеет к иномаркам. Поэтому, выбирая более престижный автомобиль между Datsun mi-DO и Lada Kalina, потребитель отдает предпочтение японским корням.

Сравнение по типу кузова

При поверхностном разборе в выборе кузова Лада выглядит практичнее Датсуна. В его распоряжении спортивная и кросс-версия, но это спорный вопрос, потому что Datsun планирует приобретать аналогичные кузова, об этом говорят сами разработчики и концепт-арт в Интернете.Оказывается, преобладание в ассортименте тел только вопрос времени.

Внешние отличия

Агрессивный воздухозаборник Kalina занимает много места в передней части автомобиля. Спереди хэтчбек выглядит уверенно, с узкой и длинной решеткой радиатора, стильной головной оптикой и скромными противотуманными фарами. В профиль машина менее стремительна и агрессивна. Корма выглядит откровенно скромно: ее украшают светоотражатели и удлиненные ножки.

По сравнению с кузовами хэтчбек Datsun mi-DO и Lada Kalina второй представитель выглядит более производительным.

Datsun шагнул далеко вперед, но в некоторых нюансах отличия заметны. Передняя часть автомобиля выглядит не так эффектно, как у российского представителя, но сочетание шестиугольного воздухозаборника на решетке радиатора удачно выбрано. Хромированная окантовка решетки радиатора четко завершает композицию экстерьера. Если рассматривать Datsun mi-DO и Lada Kalina в профиль, то особых отличий нет, а относительно кормы разница заметна только в конфигурации задней двери.

Сравнение сил

Lada Kalina — безусловный лидер в этом отношении. В машине вдвое больше силовых агрегатов. Абсолютно все двигатели имеют объем 1,6 л. При инжекторном и линейном расположении мощность агрегатов может значительно варьироваться.

Datsun mi-DO имеет моторы мощностью 82 и 87 лошадиных сил, причем первая версия — восьмиклапанная. Предел мощности силовых агрегатов достигается при 5100 об / мин, а тяга составляет 132 и 140 Нм (3800 об / мин).

Lada Kalina не имеет в своей коллекции 82-сильный мотор. Но у него есть более мощные представители — 98-сильный двигатель имеет 5600 об / мин и отдачу 145 Нм (4500 об / мин), а 106-сильный двигатель имеет 5800 об / мин и тягу 148 Нм (4000 об / мин). Также существует спортивная версия мотора, которая имеет отдачу 118 лошадей (6750 об / мин) и крутящий момент 154 Нм (4750 об / мин).

Lada Kalina имеет более мощные двигатели, чем и выигрывает у конкурента по мощности.

Трансмиссия

Особой разницы в выборе КПП нет. Сравнивая обе модели, следует отметить, что у них пятиступенчатая механическая коробка передач и четырехступенчатая автоматическая коробка передач. Для современных автомобилей это немного.

Подвеска

Datsun mi-DO и Lada Kalina имеют идентичное шасси. Спереди — всем известная стойка McPherson, а сзади — торсионная балка. Обе модели имеют типичный дизайн B-класса. Стабильность дороги и управляемость на должном уровне.В крутых поворотах чувствуется высокий клиренс, но сравнивать не спортивные автомобили.

Как и с коробкой передач в подвеске, у автомобилей паритет.

Сходство в интерьере

Оба представителя имеют ощутимое сходство в интерьере. Разработчики не стали слишком умными и спроектировали Datsun mi-DO по примеру Lada Kalina, которая называется «ходи по накатанной».

На передней панели заметны общие линии — трехспицевые рули, сходство в конфигурации центральной консоли, стиле приборной панели, подстаканниках, дефлекторах, бардачке, расположении органов управления.

Сравниваемые модели Datsun mi-DO и Lada Kalina имеют хорошо профилированные сиденья, но боковая поддержка откровенно хромает в обеих версиях. Обе машины могут похвастаться удобными задними сиденьями. Также есть высокая крыша, которая позволит пассажирам не упираться головой в потолок.

Комплектации в единой цене

Примерно в базовой комплектации Datsun mi-DO превосходит Lada Kalina. С точки зрения безопасности лучше оборудован японский хэтчбек.Помимо стандартных элементов для большинства моделей B-класса (крепление ISOFIX, электростеклоподъемники, центральный замок, радиоподготовка), японцы будут комплектоваться за те же деньги:

  • антиблокировочная тормозная система ABS,
  • Распределение тормозных сил EBD,
  • Система помощи при экстренном торможении EBA.

В более продвинутых комплектациях и Lada Kalina, и Datsun mi-DO могут похвастаться:

  • пара передних подушек безопасности (у Datsun есть дополнительные боковые подушки безопасности),
  • Система стабилизации ESP,
  • пятнадцатидюймовые диски,
  • противотуманные фары,
  • аксессуары электрические,
  • кондиционер (в mi-DO есть климат-контроль),
  • подогрев зеркал и сидений,
  • парктроник,
  • навигация,
  • аудиосистемы с дисплеями и другими опциями.

По сравнению с ценами Datsun mi-DO немного превосходит Lada Kalina.

Что в итоге?

Сравнивая хэтчбеки Datsun mi-DO и Lada Kalina, на выходе есть автомобили примерно с одинаковой стоимостью и техническими характеристиками. Это еще больше усложняет потребительский выбор.

13 сентября 2017

По сравнению с LADA XRAY и Datsun mi-DO чрезвычайно важно понимать свои потребности.Что вам абсолютно необходимо и от чего можно отказаться.

Автомобильный рынок полон сюрпризов и конкуренции, поэтому неудивительно, что даже модели одной компании должны конкурировать за покупателя, даже если они принадлежат разным брендам. Именно такая ситуация возникла при выходе на рынок нового отечественного люка Lada X Rey. Ведь ему пришлось побороться за клиента с другим игроком из альянса Renault-Nissan — хэтчбеком Datsun mi-Do.

Противник LADA XRAY оказался очень и очень грозным, прежде всего потому, что он дешевле.Поэтому выяснить, что лучше, Lada X Rei или Datsun mi-Do, крайне важно для понимания того, стоит ли переплачивать?

Престиж и размер

В данном случае справедливо говорить о равенстве машин. Конечно, Datsun — это японский бренд (принадлежит Nissan). Однако все, кто хоть немного интересуется АвтоВАЗом, понимают, что модель Mi-Do имеет самое далекое отношение к Японии. Поэтому эмблема Datsun — не более чем пиар-ход со стороны Nissan.

X Ray, как и Веста, оказались знаковыми машинами, так как заметно лучше Приоры, Калины и других творений АвтоВАЗа. Тем не менее, многие до сих пор не решаются до конца поверить в коррекцию российского концерна. Однако положительные сдвиги однозначно есть, и это самое главное!

Размеры хэтчбека Lada X Rey

Размеры (редактировать)

LADA XRAY

Datsun mi-DO

4165 мм 3950 мм
Ширина 1764 мм
1570 мм 1500 мм
Колесная база 2592 мм

Колея передняя

1492 мм
Колея задняя 1532 мм
195 мм 174 мм
Объем багажника 361 л (1207 л)
1190 кг (1650 кг)

1160 кг (1560 кг)

При сравнении параметров комментарии, как говорится, излишни.Сразу видно, что Datsun Mi-Do по всем параметрам хуже Lada X Rei. Однако каждый должен решить для себя, стоит ли доплачивать при покупке дополнительного места.

Параметры Datsun mi-do

Внешний вид

Примечательно, что дизайнеры при создании моделей пошли совершенно разными путями. Впрочем, это неудивительно, ведь XRAY создавался с нуля, а mi-DO — это переработанная копия Lada Kalina.

X Ray внешне выглядит очень броско, а фирменное тиснение на боковинах, автором которого является Стив Маттин, уже стало визитной карточкой новых моделей ВАЗ, в том числе и хэтчбека.В передней части видна такая же буква «X», но здесь она образована хромированными молдингами, которые окружают решетку радиатора и воздухозаборник, слитые в одно целое.



По сравнению с концепцией корм получился намного проще, однако не лишенным собственного очарования. Особенно впечатляют L-образные ножки и черная накладка, занимающая добрую половину заднего бампера. А завершают картину небольшие отражатели и аккуратное крыло над стеклом пятой двери.



Datsun mi-DO, как известно, создавался на базе Lada Kalina, поэтому компоновка кузова осталась прежней. Однако есть несколько серьезных изменений во внешности этой модели. В первую очередь они касаются передней части. Японцы решили отказаться от псевдоспортивного стиля Калины, а потому убрали огромную «горловину» воздухозаборника, заменив ее массивной решеткой радиатора. Также изменились бампер, фары и капот. И надо признать, что так машина выглядит намного выгоднее.



Сзади есть изменения, хотя и не такие разительные. Лапы удлиненной формы остались, но их цвет другой. Заднее стекло внизу изогнутое, в отличие от плоского на Калине. Номер с пятой двери «перекочевал» на бампер Mi-Do, а светоотражатели другие. Короче, изменений очень много, хотя все они частные.



И все же большинство, если рассматривать внешний вид моделей, считает, что Lada X Rei лучше, чем Datsun mi-Do.Российский хэтчбек выглядит намного агрессивнее и самобытнее.

Технические характеристики

Еще одно неоспоримое преимущество LADA XRAY, прежде всего, по силовым агрегатам, хотя с коробками передач не все так однозначно.

Двигатели

Datsun имеет только один мотор. Это проверенный годами ВАЗ 1,6-литровый 8-ми клапанный, мощностью 87 л. с участием. и тяга 140 Нм. Мотор, конечно, слабоват, что удивительно, ведь маркетологи японской компании ориентируют хэтчбек на молодежную аудиторию, где в почете динамика.

Тем не менее, ситуацию несколько смягчает довольно низкая пиковая мощность при 5100 об / мин и крутящий момент при 3800 об / мин. Субъективно машина довольно резво разгоняется и набирает сотню за 12 секунд. (14,3 сек. С автоматом). Однако максимальная скорость невысока — 170 км / ч. Но расход великоват и в городе он равен 9 литрам (10,4 литра с АКПП) — причина кроется в уже устаревшей конструкции мотора, хотя, надо признать, его надежность в какой-то мере компенсирует отсутствие технологичности.

8-клапанный двигатель mi-Do

У

Lada X Rey два двигателя, и каждый из них мощнее, чем у конкурента. Линейку открывает 106-сильный 16-клапанный, который разработан на базе агрегата типа ВАЗ-21129. Пиковая мощность этого 1,6-литрового двигателя LADA XRAY составляет 5800 об / мин, а максимальный крутящий момент составляет 148 Ньютонов при 4200 об / мин.

Несмотря на преимущество в 19 л. с участием. и наличие 16 клапанов, превосходство в динамике очень небольшое — 0.6 сек. Размена сотни занимает 11,4 секунды, а максимальная скорость 174 км / ч недалеко от ми-до. Аппетит примерно такой же и чуть превышает 9 литров.

1,6-литровый силовой агрегат X Ray

Однако следующий двигатель Lada X Rey намного лучше! Это уже самостоятельная разработка АвтоВАЗа — атмосферный двигатель объемом 1,8 литра мощностью 122 л. с участием. Он имеет рядную компоновку и инжектор, что позволяет ему развивать крутящий момент 170 Нм.Увеличение «кубатуры» наилучшим образом сказалось на динамических характеристиках — разгон за 10,4 секунды, при максимальной скорости 185 км / ч, обеспечивает комфортную езду и уверенный обгон как в городе, так и на трассе. При этом инженерам удалось сохранить расход на уровне 9,3 литра, что для такого объема очень хорошо.

122 л.с., 1,8-литровый вариант

В целом из сравнения двигателей видно, что X Rey лучше Mi-Do.Его силовые агрегаты более совершенные, мощные и тяговитые, несмотря на то, что аппетиты примерно такие же. По сути, Дастун может составить конкуренцию Lada, но только с базовым двигателем — по динамике он не сильно отстает.

Трансмиссии

Но в сравнении коробок передач LADA XRAY и Datsun mi-DO все намного сложнее, чем с моторами. Что касается механических составляющих, то здесь все ясно. Обе модели имеют 5-ступенчатые коробки передач. Единственное принципиальное отличие — отечественная трансмиссия принята для Mi-Do, а французская — для X Ray.

X Ray комплектуется французской МКПП

Как бы то ни было, но к обоим узлам серьезных претензий нет. Хотя претензии к МКПП mi-DO до сих пор есть — выбор передачи не всегда ясен, особенно если речь идет о задних оборотах, к тому же коробка передач иногда воет при движении, что диссонирует с гордостью Nissan, представители которой хвалят коробку передач, подчеркнув наличие в ней тросового привода… Поэтому механика X Ray все же лучше.

Коробка механическая Datsun

В отношении автоматических узлов все намного сложнее. XRAY имеет 5-диапазонный AMT — это роботизированная коробка на базе МКПП 21826. Выбор такой трансмиссии, а не классической автоматической, был продиктован экономическими соображениями. Сама коробка в целом неплохая, а в обслуживании проще и дешевле автомата, хотя при переключении не задумываясь, иногда, негде.

5-ступенчатая AMT Лада

Что касается mi-DO, то у него классическая АКПП, но только 4-диапазонная, от компании Jatco. Автомат очень удобен, особенно учитывая ценовой сегмент, а еще в нем есть режим удержания пониженных передач. Однако есть и большой недостаток — с такой АКПП динамика хэтчбека, и без того несовершенная, становится совсем «нулевой», а расход топлива значительно увеличивается.

4-диапазонная АКПП mi-Do

Поэтому сложно определить победителя в вопросе, что выбрать, Lada X Rey или Datsun mi-Do с АКПП.С одной стороны, у Лады 5-ступенчатая АМТ, хотя и не без изъянов при переключении. Зато у Датсуна 4-диапазонная автоматическая трансмиссия, которая хоть и удобная, но совсем не блещет динамикой, что при обгоне превращается в большую проблему.

Шасси

Шасси Datsun mi-DO и LADA XRAY конструктивно одинаковы, в общих чертах, конечно. Обе модели оснащены стойками Макферсон на передней оси, а также полунезависимой компоновкой на задней.Особенность соперников — энергоемкость, однако, как выяснилось, энергоемкость другая …

На X Ray можно спокойно ездить по разбитой трассе, не опасаясь поломок стоек до ограничителя. И каждую мелочь или лежачие полицейские можно полностью игнорировать. Однако обратная сторона этих преимуществ — высокая парусность и заметные крены в углах, поэтому заходить в углы нужно осторожно.

Схема подвески X Ray

В mi-Do подвеска вроде тоже энергоемкая и поломок не боится, только на руле и сиденьях отражаются все неровности дороги.В результате машину сильно трясет в ямах, а если ехать слишком быстро, задний мост может даже унести в сторону, выбивая ее из колеи, особенно зимой.

Схема шасси Datsun

Отдельный разговор о проходимости. Здесь XRAY лучше mi-DO и многое другое. Объясняется все двумя основными факторами — высоким клиренсом и наличием отключаемой системы ESC, благодаря которой модель ВАЗ может уверенно ездить даже по грязной грунтовке.Что касается Mi-Do, то этот хэтчбек благодаря значительному для этого класса клиренсу вкупе с небольшими свесами кузова обладает еще и хорошей проходимостью. Однако X Ray явно не дотягивает.



И все реальные возможности LADA XRAY с отключенным ESC наглядно демонстрируются в сюжете «Ладной механики».

Интерьер

Дизайн моделей, конечно, совершенно другой, но это не отменяет того факта, что внутри Lada X Rey выглядит лучше, чем Datsun mi-Do.

Салон хэтчбека ВАЗ создавался с нуля, хотя многие считают это при заметном взгляде на корейские модели. Как бы там ни было, но интерьер получился очень красивым и самобытным. Выделяется подсветка приборной панели со стильными колодцами, а перед ней возвышается спортивный руль. Удлиненные воздуховоды и большой дисплей на центральной консоли идеально сочетаются с остальными элементами.



Сзади достаточно комфортно, хотя дуэт гонщиков поедет там с максимальным комфортом.Передние сиденья тоже солидные, но следует учитывать, что в базовой комплектации поясничная поддержка занижена. В остальном проблем нет. Багажник XRAY почти в 1,5 раза больше, чем у конкурента.



Салон

mi-Do полностью скопирован с седана On-Do, а тот, в свою очередь, получил его от Гранта, хотя и доработанный. Тем не менее, у японцев не было возможности создать полностью оригинальную конструкцию, и поэтому они попытались переработать существующую.Результат, как видите, оказался неплохим. Салон mi-Do более строгий, чем у Granta, и менее кричащий.



Черный пластик гармонично разбавлен металлическими вставками, а также хромом (но только в топовых комплектациях). Руль достаточно удобный, а сиденья очень радуют как рамой и наполнителем, так и боковой поддержкой. Кроме того, в максимальных версиях есть регулировка сиденья по высоте.



Опции и цены

LADA XRAY имеет в списке 3 комплектаций — Оптима, Люкс и Эксклюзив.А вот Datsun mi-DO 2 версии — Trust и Dream, правда, у первого 3 степени оснащения, а у второго 2. Поэтому у японского хэтчбека 5 комплектаций. По цене Datsun заметно дешевле. Его стоимость начинается от 515 000 рублей против 599 900 рублей у LADA. Вверху цифры следующие — 652 000 рублей против 830 900 рублей.

LADA X REY

Оборудование

Характеристики

Цена, руб.)

1,6 л 16-кл. (106 л.с.), 5МТ 629 900
Optima / Кондиционер 1,6 л 16-кл. (106 л.с.), 5МТ
1,6 л 16-кл. (106 л.с.), 5МТ 690 900
Optima / Кондиционер

Optima / Кондиционер

1,8 л 16-кл. (122 л.с.), 5МТ 739 900
Люкс 1.6 л 16-кл. (106 л.с.), 5МТ
1,8 л 16-кл. (122 л.с.), 5AMT 740 900
Люкс / Престиж 1,6 л 16-кл. (106 л.с.), 5МТ
1,8 л 16-кл. (122 л.с.), 5МТ 775 900
Люкс 1,8 л 16-кл. (122 л.с.), 5АМТ
1,8 л 16-кл. (122 л.с.), 5МТ 825 900
Люкс / Престиж 1.8 л 16-кл. (122 л.с.), 5АМТ
1,8 л 16-кл. (122 л.с.), 5АМТ 860 900
Люкс / Престиж 1,8 л 16-кл. (122 л.с.), 5МТ
1,8 л 16-кл. (122 л.с.), 5МТ

Подробнее о ценах и комплектации LADA XRAY вы можете узнать по ссылке

DATSUN MI-DO

Оборудование

Характеристики

Цена, руб.)

1,6 л 87 л. с участием. 5МТ 536 000
Доверие i 1,6 л 87 л. с участием. 4АТ
1,6 л 87 л. с участием. 5МТ 560 000
Trust ii 1,6 л 87 л. с участием. 4АТ
1,6 л 87 л. с участием. 5МТ 570 000
Доверие III 1.6 л 106 л. с участием. 5МТ
1,6 л 87 л. с участием. 4АТ 620 000
Мечта I 1,6 л 87 л. с участием. 5МТ
1,6 л 106 л. с участием. 5МТ 609 000
Мечта I 1,6 л 87 л. с участием. 4АТ
1,6 л 87 л. с участием. 5МТ 623 000
Мечта II 1.6 л 106 л. с участием. 5МТ
1,6 л 87 л. с участием. 4АТ

Более подробную информацию о ценах и комплектации Datsun mi-DO вы можете найти по ссылке

Если сравнивать комплектации, то станет заметна общая тенденция — и Lada, и Datsun пошли на сокращение количества опций в базовых версиях, чтобы обеспечить водителю и пассажирам достойный уровень безопасности. В частности, обе модели имеют передние подушки безопасности, а также электронные системы ABS, BAS и EBD.Однако в X Ray дополнительно есть ESC, TCS и HSA. Также в автомобилях есть минимальный комплект оборудования, включающий бортовой компьютер, зеркала с подогревом, складывающуюся спинку заднего сиденья в соотношении 60/40 и многое другое.

Один из вариантов оснащения Лады

Естественно, что с повышением цены на машину комплектация становится все более богатой. Появляется мультимедийная система с дисплеем, полный электропакет, подогрев передних сидений и лобового стекла, круиз-контроль и другое оборудование.В целом X Ray богаче оборудованием, но не на порядок.

Мультимедиа Mi-Do доступна только в дорогих версиях

А это значит, что переплата за хэтчбек ВАЗ в первую очередь связана с его техническими характеристиками, в частности, с более мощными двигателями. И в меньшей степени по габаритам, маневренности и оснащению. Поэтому, если вам просто нужна честная машина, без лишних изысков, смело берите Datsun mi-Do.Но если хочется большего, то Lada X Rey — ваш выбор!

Datsun mi-DO и Lada Kalina: сравнение хэтчбеков

Сравнивая между собой Datsun mi-DO и Lada Kalina, автомобилисты сталкиваются с непростым вопросом: «Какой хэтчбек лучше?» Ведь на самом деле одна из машин легко может превосходить другую по некоторым параметрам, но заметно уступать по остальным. Например, отечественная Lada превосходит Datsun по практичности и более мощным силовым агрегатам, но уступает ему по оснащению и стилю.

Выбор между MI-DO и Kalina осложняется тем, что автомобили имеют примерно одинаковую ценовую категорию.

Лада уступает по престижности Datsun

Не стоит думать, что японцы по популярности превосходят отечественного представителя. Обе машины собираются с одинаковой скоростью и сходят с конвейера на одном заводе. Но психология российского потребителя построена несколько иначе и при выборе авто тяготеет к иномаркам.Поэтому, выбирая более престижный автомобиль между Datsun mi-DO и Lada Kalina, потребитель отдает предпочтение японским корням.

Сравнение по типу кузова

При поверхностном анализе в выборе кузова автомобиля Lada выглядит практичнее Datsun. В его распоряжении спортивная и кросс-версия, но это спорный вопрос, потому что Datsun планирует приобретать аналогичные кузова, об этом говорят сами разработчики и концепт-арт в Интернете. Оказывается, преобладание в ассортименте тел только вопрос времени.

Внешние различия

Агрессивный воздухозаборник Kalina занимает много места в передней части автомобиля. Спереди хэтчбек выглядит уверенно, с узкой и длинной решеткой радиатора, стильной головной оптикой и скромными противотуманными фарами. В профиль машина менее стремительна и агрессивна. Корма выглядит откровенно скромно: ее украшают светоотражатели и удлиненные ножки.

По сравнению с кузовами хэтчбек Datsun mi-DO и Lada Kalina второй представитель выглядит более производительным.

Datsun шагнула вперед не далеко, но в некоторых нюансах отличия заметны. Передняя часть автомобиля выглядит не так эффектно, как у российского представителя, но сочетание шестиугольного воздухозаборника на решетке радиатора удачно выбрано. Хромированная окантовка решетки радиатора четко завершает композицию экстерьера. Если рассматривать Datsun mi-DO и Lada Kalina в профиль, то особых отличий нет, а относительно кормы разница заметна только в конфигурации задней двери.

Сравнение сил

Лада Калина — безусловный лидер в этом отношении. В машине вдвое больше силовых агрегатов. Абсолютно все двигатели имеют объем 1,6 л. При инжекторном и линейном расположении мощность агрегатов может значительно варьироваться.

Datsun mi-DO имеет моторы мощностью 82 и 87 лошадиных сил, причем первая версия — восьмиклапанная. Предел мощности силовых агрегатов достигается при 5100 об / мин, а тяга составляет 132 и 140 Нм (3800 об / мин).

Лада Калина 82-сильного мотора в своей коллекции не имеет. Но у него есть более мощные представители — 98-сильный двигатель имеет 5600 об / мин и отдачу 145 Нм (4500 об / мин), а 106-сильный двигатель имеет 5800 об / мин и тягу 148 Нм (4000 об / мин). Также существует спортивная версия мотора, которая имеет отдачу 118 лошадей (6750 об / мин) и крутящий момент 154 Нм (4750 об / мин).

Lada Kalina имеет более мощные двигатели, чем и выигрывает у конкурента по мощности.

Трансмиссия

Особой разницы в выборе КПП нет. Сравнивая обе модели, следует отметить, что у них пятиступенчатая механическая коробка передач и четырехступенчатая автоматическая коробка передач. Для современных автомобилей это немного.

Подвеска

Datsun mi-DO и Lada Kalina имеют идентичное шасси. Спереди — всем известная стойка McPherson, а сзади — торсионная балка. Обе модели имеют типичный дизайн B-класса. Стабильность дороги и управляемость на должном уровне.В крутых поворотах чувствуется высокий клиренс, но сравнивать не спортивные автомобили.

Как и коробка передач в подвеске, у автомобилей паритет.

Внутреннее сходство

Оба представителя имеют ощутимое сходство в интерьере. Разработчики не стали слишком умными и спроектировали Datsun mi-DO по примеру Lada Kalina, которая называется «ходи по накатанной».

На передней панели заметны общие линии — трехспицевые рули, сходство в конфигурации центральной консоли, стиле приборной панели, подстаканниках, дефлекторах, бардачке, расположении органов управления.

Сравниваемые модели Datsun mi-DO и Lada Kalina имеют хорошо профилированные сиденья, но боковая поддержка откровенно хромает в обеих версиях. Обе машины могут похвастаться удобными задними сиденьями. Также есть высокая крыша, которая позволит пассажирам не упираться головой в потолок.

Комплектации по одной цене

Примерно в одинаковых базовых комплектациях Datsun mi-DO превосходит Lada Kalina. С точки зрения безопасности лучше оборудован японский хэтчбек.Помимо стандартных элементов для большинства моделей B-класса (крепление ISOFIX, электростеклоподъемники, центральный замок, радиоподготовка), японцы будут комплектоваться за те же деньги:

  • антиблокировочная система тормозов ABS,
  • тормоз
  • Распределение усилия EBD,
  • Система помощи при экстренном торможении EBA.

В более продвинутых комплектациях и Lada Kalina, и Datsun mi-DO могут похвастаться:

  • парой передних подушек безопасности (у Datsun есть дополнительные боковые подушки безопасности),
  • системой стабилизации ESP,
  • пятнадцатидюймовыми дисками,
  • противотуманные фары,
  • эл. аксессуары
  • , кондиционер
  • (в mi-DO есть климат-контроль),
  • подогрев зеркал и сидений,
  • парктроник,
  • навигация,
  • аудиосистемы с дисплеями и другие опции.

По сравнению с ценами Datsun mi-DO немного превосходит Lada Kalina.

Что в итоге?

Сравнивая хэтчбеки Datsun mi-DO и Lada Kalina, на выходе есть автомобили примерно с одинаковой стоимостью и техническими характеристиками. Это еще больше усложняет потребительский выбор.

datsuner.ru

Хрен васаби не слаще. Лада или Датсун? — тест-драйв, обзор Datsun on-DO, Lada (ВАЗ) Kalina Cross

Как можно сравнивать такие разные автомобили? Ситуация, между тем, реальная, если вам нужна новая машина на все случаи жизни, а в кармане чуть больше полумиллиона денег.Нет времени на вкусовые прихоти. Вот и подумаете: берите бюджетную иномарку без прикрас или российское изделие, но с бонусом в виде универсального кузова и штуковин кроссовера.

Lada Kalina CrossDatsun on-DO

Почти «джипы»

Общего между on-DO и Cross больше, чем кажется. Поскольку Datsun по названию «японец», но создан на базе переднеприводной платформы ВАЗ «Калина» / «Гранта» и стоит на конвейере в Тольятти.Даже если седан формально лишен увеличенного клиренса и пластиковых щитов — цифры говорят, что бездорожья в нем не меньше. Если под стальным листом моторного отсека «Лады» мы замерили почти 19 см, то при той же силовой защите on-DO дорожный просвет всего на сантиметр скромнее. Да, пороги и бамперы свисают чуть ниже, задний свес длиннее, но на фоне других бюджетников Датсун отнюдь не пузотерка, грунтовок не боится.

Даже усилим: любит грейдеры on-DO и проселочные дороги, так как энергопотребление подвески выше, чем у «Кросса»! А это серьезное приложение, ведь Калина не так давно удивила нас равнодушием к разбитой поверхности. Но если шасси «Жигулей» иногда огорчает стуками при выключенном свете, то Datsun бесшумно пинает дорогу вниз, как бы вы ни водили. Разве что начинает трясти пассажиров с нарастающей скоростью.

Lada Kalina CrossDatsun -OO

Один килограмм на руках, другой больше кушает

На асфальте седан тоже по-другому ведет себя.Datsun более устойчив на прямой и не так сильно прыгает от порывов бокового ветра. Это связано не только с меньшей высотой включения DO, но и с измененной конфигурацией электрического усилителя. Ему явно привили прогрессивную характеристику, хотя усилие на руле все равно растет неадекватно: в поворотах руль резко утяжеляется и при наезде на неровности бьет руками. Лада защищает ладони водителя, однако о положении передних колес здесь, наверное, можно догадаться — вязкое рулевое управление не очень информативно.

Калина Кросс, как и ожидалось, превосходит на-ДО по динамике разгона. Ведь за те же деньги Лада предлагает револьверный 16-клапанный двигатель объемом 1,6 л (106 л.с.) и короткую главную пару в коробке, а лимит Datsun — это старинный ВАЗ с 8 клапанами мощностью всего 87 л.с. и «длинная» передача. В результате разница разгона до «сотни» составляет почти 1,5 секунды (10,8 против 12,2).

Lada Kalina CrossDatsun on-DO

Однако on-DO совсем не ощущается «овощем».Его характеристики тяги и мощности достигают максимума при более низких оборотах, что удобно в городе. А на трассе Datsun благодаря упругому двигателю не сдается, не напрягаясь, сохраняя темп «Калины». При этом on-DO оказался немного экономичнее, показав средний расход 7,5 л / 100 км против 7,8 у Lada. Бензин, кстати, числится 95-м на обе модели.

Есть отличия даже в звукоизоляции. Те же 15-дюймовые шины Pirelli Cinturato P1 отчетливее слышны на on-DO.Колесные арки «Калины» демпфируются лучше, но на высоких скоростях (более 100 км / ч) универсал больше раздражает свистящий ветер. В целом акустический комфорт сопоставим.

Lada Kalina CrossDatsun on-DO

Машины ездят по-разному, но в салоне родственные узы вылезают из всех щелей. Расположение передней панели, обзор, посадка … Канонические параметры определялись общей платформой. И тут начинается игра оттенков дизайна и оборудования.Например, комбинация приборов on-DO выглядит проще, но лучше читается и не слепит. Для «Датсуна» доступен мультимедийный комплекс с навигацией и сенсорным экраном, а «Калина» отвечает веселыми оранжевыми вставками в отделке салона и бардачком в верхней части «торпеды». Порт USB у «японца» спрятан в нише бардачка, а у «Лады» — на виду.

Даже размеры салонов одинаковые. Только во втором ряду Креста по понятным причинам места над головой больше — крыша в универсале поднимается выше.А крепления Isofix сделаны грамотнее: установить детское кресло в on-DO не проще, чем поймать всех покемонов на улице. Хотя по безопасности он все же опережает «Жигули» за счет недоступных «Кроссу» боковых подушек безопасности и системы стабилизации.

Lada Kalina CrossDatsun on-DO

Грузоподъемность Калины побольше. Но в базовой комплектации багажник седана с длинной кормой, конечно, просторнее, причем в полтора раза (530 литров против 355).Такой огромный «пенал» удобен для сумок и пакетов, но не подходит для крупных предметов.

Сколько стоит быть японцем?

Японское качество? Похоже на то. Datsun воспринимается как более цельный продукт! Двери у него закрываются тише, жесткая передняя панель меньше скрипит, коробка не воет при отпускании дроссельной заслонки, а из неприятных моментов мы встречали только хрустящий руль. Напомним, Лада, находившаяся всего в 10 тысячах километров, выдавала кучу мелких болячек и в сырую погоду трясло двигатель трясущимся мотором.С другой стороны, долгие испытания седана on-DO также вызвали беспокойство. Так что, похоже, нас снова просят сыграть в лотерею — независимо от того, получится ли удачная копия или нет.

Lada Kalina CrossDatsun -OO

А вот за официальное обслуживание по «зарубежным» меркам придется доплачивать без опций. Например, обслуживание on-DO первых 30 000 км будет стоить почти в 1,5 раза дороже. Стоит ли свечки? Если вы любите управлять собой, хотите ездить по любым дорогам и слово Lada кружит вам голову — покупайте Datsun, хотя иномарка от него чисто формальная.Калина Кросс впечатляет своей функциональностью: везде ездит, много берет на борт, дешевле в обслуживании и хорошо выглядит.

auto.mail.ru

Datsun или Kalina 2 — Datsun Gon do или Lada Kalina II? Есть ли принципиальная разница? — 22 ответов

В разделе Выбор автомобиля, мотоцикла на вопрос Datsun Gon do или Lada Kalina II? Есть ли принципиальная разница? дано автором Григорием Коваленко лучший ответ Лада

Ответ из 2 ответов [гуру]

Эй! Вот подборка тем с ответами на ваш вопрос: Datsun Gon do или Lada Kalina II? Есть ли принципиальная разница?

Ответ с www www [гуру] что-то G, что-то G

Ответ Андрея 163 [гуру] Калина конечно.Разница в шильдике и в цене услуги. Кузов полностью из гранты / калины. А у Датсуна мотор 8-ми клапанный, ты думаешь там японский ??? нет, пихали наши … хоть калина имеет двигатели на выбор из более мощных 16 клапанов

Ответ 137 [гуру] Конечно есть — на-ДО это седан, а Калина — хэтчбек и универсал . Datsun mi-DO — это конкурент Калины (ее копия). ссылка

Ответ Дениса [гуру] Конечно, ВАЗ.В Datsun он стоит столько же, как правило, один к одному … только кузов будет дороже, да и оборудование тоже. Я был удивлен, когда увидел двигатель от Granta на соседнем Datsun. Пластик тот же дуб, только дизайн другой.

Ответ Виктора Ковалеффа [гуру] «Гон делать» .. даже как презерватив слышно русским ухом. В общем машина нуждается в распиле, а деньги на исходе! Не до Мерседеса. Возьмите Калину. С запчастями проблем еще меньше.Все-таки его завод, дилеры, сервисные центры и дядя Вася в гараже больше знаком с «Жигулями», чем с «Дацун-Гоном». С Калиной проще, сломается, обязательно отремонтируют, с минимальными затратами.

Ответ Александра Куликова [гуру] Я уже отговорил одного из Datsun, хотя он хотел иномарку

Ответ Пула kp.ss [гуру] Дацун Шумак лучше

Ответ от oman [гуру] — это Фактически же разница заключается во внешнем виде.узнайте стоимость кузовных деталей на обе машины и определитесь, какая лучше. Технически они идентичны: двигатель, трансмиссия, подвеска, электрооборудование одинаковы.

Ответ от ~ (K @ Re-glazy) ~ [гуру] см. Обзор от mail ru. но Датсун лучше по шумоизоляции и надежности. было что-то вроде теста между ленивым грантом дацун, который он делает, и фод фиестой, так что дацун победил!

Ответ из 2 ответов [гуру]

Эй! Вот еще несколько тем с нужными вам ответами:

Ответьте на вопрос:

22oa.ru

Тест-драйв на женском автопортале Careta.info

Возрожденный бренд Datsun в России, если не бьет рекорды, уж точно не бледнеет: продажи on-Do и mi-Do держатся на очень хорошем уровне , несмотря на все скептические высказывания в их адрес и сравнение с Ладами. Сама марка была «вытащена из закромов» Nissan, где пролежала почти сорок лет. В те годы это был основной бренд компании, позже известной как Nissan, и автомобили под этой маркой успели выйти на дороги России в начале девяностых.Его возрождение в качестве бюджетного локализованного бренда — хорошее предзнаменование: это означает, что Renault-Nissan после некоторой доработки готовы использовать плоды российской инженерии под собственным, пусть и не главным, брендом.

Сравнение автомобиля с Lada Kalina очевидно, но не стоит рассматривать Datsun просто как еще одну его модификацию. Современные автомобили отличаются друг от друга нюансами, расстановкой приоритетов и деталями исполнения, поэтому в mi-Do немного другая атмосфера, попытка сделать машину «более разной», в первую очередь, более японской.И пусть вас не вводят в заблуждение изменения внешнего вида: в отличие от старой советской школы «модернизации», когда хвостовая часть автомобиля и внешние панели менялись раз за разом, оставляя неизменной свою сущность, здесь внешний вид не меняли вовсе для галочки. и «освоение новой модели к XVIIIIIIIIIIIIIII съезду КПСС», но сразу подчеркну — машина теперь совсем другая. Да, взаимосвязь скрыть не удалось, но такая задача явно не ставилась. Судя по отзывам У тех, кто занимался доводкой этого автомобиля, цель была другая — максимально изменить подход к качеству исполнения, повысить надежность и придать автомобилю более породистые манеры вождения.

Что касается надежности, то явно решили пойти по пути перестрахования. Самый надежный и простой из всей линейки двигателей ВАЗ, восьмиклапанный 11186 мощностью 87 л.с., японская АКПП Jatco и полное отсутствие каких-либо сложных агрегатов, проверенные комплектующие и выбор поставщиков для обеспечения максимальной качество исполнения. Я бы сказал, что для дешевой машины все получилось хорошо, только недорогие сиденья, звук бипер-сигнала поворотов и несколько странно работающие тормоза остались в салоне серьезными раздражителями, однако последнее явно особенность конкретного экземпляра .

В остальном салон даже приятен: лишний раз не гремит, он сделан из дешевых, но не надоедливых материалов, получил отличную приборную панель. . Она не слишком отличается от соплатформенной Калин, но меньшее количество мелких недочетов сборки, которые проявляются в виде щелчков или плохой работы крышек, защелок и ручек. В дальнейшем отличия исчезнут — по договоренности между компаниями все нововведения Datsun будут реализованы на Kalina, а значит, все приятные изменения появятся на Ladas в кратчайшие сроки.И главное изменение, которого стоит дождаться, — это звукоизоляция, как ни странно, новый подход дает о себе знать. Нет, машина не стала «шестисоткой» и даже далека от какой-то Октавии, но явные недостатки в виде шума от колесных арок и повышенного шума в задних сиденьях, скрипы и стуки в салоне убраны, теперь работает даже задний дворник тихо. Двигатель звучит как обычно, может, чуть глуше, но за полное отсутствие шума трансмиссии отвечает новая АКПП, с ней исчезает привычный всем вазоводникам тихий вой, особенно раздражающий при торможении двигателем.В остальном следует надеяться на работу по выбору поставщиков комплектующих и совершенствованию процесса покраски, изменение ассортимента сталей, используемых для производства кузовов, и другие, казалось бы, незначительные изменения. В отличие от товаров для гаражного тюнинга, здесь учитывается простота обслуживания и вес автомобиля.

Корни, однако, налицо: высокая Калиновская посадка никуда не исчезла, сиденья изменились минимально, и я надеюсь, что скоро их заменят на что-то существенно более продвинутое в условия легкости посадки.Взгляд натыкается на технические решения, знакомые каждому, кто водил «Жигули», такие как тонкая ножка ручника, торчащая прямо из пола, нахлест коврики через центральный туннель сзади, тонкие солнцезащитные козырьки — в общем, на родинках старой платформы. . Скрывать их и покидать базу, наверное, нет смысла. У ВАЗа будет новая платформа, более современная и удобная, и нужно будет ее использовать, а не заниматься косметическими доработками старой, пока задача решена.Качество исполнения и ходовые качества изменились с минимальными доработками.

Хотя размер салона остается минимальным, чтобы вместить четырех человек, он уже тесен для пяти. Багажник вмещает пару небольших чемоданов и все, ведь можно сложить задние сиденья и унести что-нибудь значимое. Здесь даже вмешательство Nissan не может выжать из старого кузова еще больше места, хорошо видно, что платформа уже устарела.Зато обивка теперь из приятного глазу и на ощупь материала, не торчат ни болты, ни острые края, с этим все нормально.

Новые настройки подвески приятно меняют поведение автомобиля: оно менее импозантно и гораздо ближе к «лучшим образцам», но с хорошим акцентом на проходимость и легкое безразличие. Причем амортизаторы здесь те же СААЗы, но доработанные, к тому же немного изменены характеристики жесткости кузова и некоторых других элементов подвески.По сравнению с предыдущим поколением Калин — небо и земля, по сравнению с нынешним — просто машина приятнее в движении, но сразу понять почему. К сожалению, здесь установлен не электрический усилитель «водитель», а только модель, которая снижает «ощущение руля», делая его легче и менее чувствительным. Помню, на тест-драйве лифтбека Гранта ощущения от рулевого управления были намного приятнее, хотя порой руль оказывался даже тяжеловесным в поворотах.Но судя по тому, что Datsun принципиально комплектуются не самым мощным из доступных двигателей, к спортивности они вообще не стремились.

Но дуэт последней модификации старого доброго мотора, восходящего к 1300-кубовой разработке Porsche 2108 и японского четырехступенчатого автомата, очень хорош, возможно, даже приятнее на ходу, чем тот же АКПП с 98-сильным мотором ВАЗ. Восьмиклапанная заметно лучше тянет на низких оборотах, а автомат не пытается тянуть до последнего, легко переключает «вниз» при недостатке тяги.В городе этой паре очень везет, пока в машине не окажется больше одного-двух пассажиров, и даже шестнадцатиклапанный с механикой не может тянуть машину с полноценным салоном. Определенную заслугу в ощущении динамики следует отдать шумоизоляции, благодаря которой скручивание мотора «звенит» не слишком утомительно для ушей. Кстати, в отличие от Гранты, здесь в недрах экрана на приборной панели указатель температуры не спрятан, а постоянно отображается, заставляя лишний раз вспомнить, что для долгой и счастливой службы двигателя нельзя пренебрегать подогревом.Под капотом вас ждет небольшая порция ностальгии — новомодных пластиковых накладок, закрывающих двигатель, вас встретит до боли знакомый всем владельцам «девяток» клапанный силуэт. Но хомуты новые, материал шлангов и бачков явно другой, с ностальгией не перестарались.

В целом машина ничем не выделяется, недостатки платформы устранены предельно аккуратно, и в этом ее главное преимущество.Автомобиль тщательно сохранил приличный уровень проходимости, высокий клиренс — почти как у других кроссоверов — и небольшие свесы. И в итоге получаем … да, это точно Datsun, а вовсе не Lada, с его чванством, дешевизной и невниманием к мелочам, традиционным равнодушием по отношению ко всем характеристикам подвески, кроме «всеядности» и силы. Приятно осознавать, что мало-помалу автомобили АвтоВАЗ научатся делать то же самое, с вниманием и уважением к простым потребностям вождения, осторожно и с любовью, а mi-Do действует как пробный шар, и если он станет популярным, он станет стать символом того, что люди хотят перемен.в этом направлении.

Официальный дилер datsun he do в Вологде

Представитель отечественного автопрома Лада Калина является прямым конкурентом японского аналога Datsun mi-DO. Сходные технические характеристики, конструкция кузова и одна ценовая категория ставят в тупик при выборе подходящей модели. Отличия заключаются в мелочах и эстетических впечатлениях от езды, о которых мы поговорим в этой статье.

Внешний вид и расположение

Обе машины отличаются изящными формами и дизайном кузова.Вариативность цветовых решений у Lada шире: доступно 12 цветов против 6 у Datsun. В Японии популярны модели с коричневым кузовом, а среди отечественных автовладельцев чаще встречаются белые версии. Тип кузова 6-дверного авто — универсал.

Воздухозаборник с мощными сквозными отверстиями у Калины занимает львиную долю передней части. Японский хэтчбек оснащен более скромной и вытянутой решеткой радиатора, а также привлекательной оптикой. Lada выглядит практичнее и имеет в своем арсенале спортивную версию с жесткой подвеской, а также кросс-версию.Японский конкурент имеет версию седан и выглядит солиднее. Обе машины рассчитаны на юную публику.

Внутренняя отделка

Стилистика салонов сравниваемых хэтчбеков во многом идентична. Однако отличия заключаются в мелких деталях — у Datsun матовый пластик, выполненный в темно-серых тонах, с приятными тактильными ощущениями. Пластиковые элементы российской модели выполнены из фактурного материала с матовым покрытием. В кросс-версии центральная часть обивки сиденья, рулевой мост и дверные вставки выделяются ярко-оранжевыми цветами и выглядят свежо и молодо на фоне темного пластика.Дизайн и расположение остальных элементов аналогичны. Руль с 3 спицами, варианты функциональных панелей, консоли, двойной подстаканник и вентиляционные отверстия имеют схожий внешний вид.

Силовые агрегаты — сравнительные характеристики

Что касается двигателей, то отечественный бренд заметно превосходит зарубежный аналог — как по количеству силовых агрегатов, так и по пиковой мощности. У Лады 3 варианта двигателя, в том числе спортивная версия, у Datsun всего 2 варианта. Преимущество Калины наглядно показано в таблице ниже:

Подача топливно-воздушной смеси в двигатель иномарки регулируется электронной системой (инжектором), а объем обоих вариантов двигателя равен единице -1.6 литров. «Лада» преодолевает отметку 100 км / ч за 12,5 секунды, а своего конкурента — за 12,9 секунды. По уровню шума российская модель идентична и сопоставима с дизельными аналогами. Если в приоритете силовые и скоростные характеристики автомобиля, выбор остается за Калиной.

Элементы подвески Лада Калина и Датсун

Подвесные системы обеих марок идентичны. Передняя подвеска отличает классическая подвеска Макферсон, задняя подвеска торсионная.Конструктивное устройство подвесок типично для автомобилей типа «псевдо-внедорожник» сегмента B. На практике модели показали неплохие результаты. В условиях бездорожья устойчивость сохраняется и только на крутых поворотах чувствуется небольшое снижение управляемости. Дорожный просвет у Лады чуть больше.

Коробка передач — отличия

Отечественная марка комплектуется ККП механического или автоматического типа. У японского аналога только 4-ступенчатая МКП.

Комплектация и цена Datsun mi-DO и Лада Калина

Базовая комплектация Datsun mi-DO богаче, несмотря на одну ценовую категорию.В распоряжении японского бренда доступны версии «Trust», а также вариация «Dream». В наличии двойные подушки безопасности, антиблокировочная система тормозов ABS, функция распределения тормозной нагрузки EBD и ассистент экстренного торможения EBA. Среди достоинств Datsun — также подогрев окон и сидений, продвинутая акустическая система со светодиодной панелью, Bluetooth и GPS.

Комплектация Калины

скромнее: магнитола, передняя подушка безопасности, электрические передние стеклоподъемники и центральный замок. Цена вариации стандартной версии Калины составляет 370-540 тысяч рублей, Datsun mi-DO — 490-539 тысяч рублей.

Окончательное сравнение: за и против

Суммируем сильные и слабые стороны автомобилей.

Преимущества Лада Калина:

  • вместительный салон и багажник;
  • отличная оптика;
  • наличие запчастей;
  • умеренный расход топлива;
  • мощность.

Недостатки Калины:

  • скромное оборудование;
  • Не самое удобное расположение органов управления.

Достоинство Datsun mi-DO:

  • маневренность и вместительность;
  • удобство салона;
  • богатая комплектация.
  • Недостатки:
  • менее мощный;
  • запчасти не всегда в наличии;

Видеообзор сравнения Lada Kalina и Datsun mi-DO

Заключение

Lada Kalina и японский конкурент Datsun mi-DO — достойные автомобили среднего класса со схожими техническими характеристиками.Модели находятся в одной ценовой категории, а основные различия заключаются в конфигурации, мощности двигателя и вариативности доступных версий.

В конце февраля в компании нескольких блогеров и автожурналистов меня пригласили на тест-драйв нового хэтчбека … Когда я сообщил о своем временном отсутствии и его причинах на основной работе, оказалось, что три Взрослые из числа моих коллег раньше даже не слышали о некогда легендарной японской автомобильной марке. Datsun … Следуя этой логике, думаю, что среди читателей этого уютного фотоблога найдется много тех, кто еще не знаком с этой маркой. Но, между тем, это дочерняя марка концерна Nissan и сейчас переживает свое второе рождение. Честно говоря, я мало что знал о Datsun и о себе, но тем интереснее было в итоге принять участие в этом мероприятии.

Да просто хочу предупредить тех, кто уже в «теме» и начал выскакивать комментарий в духе «Да это просто доработанная Калина!» Друзья, не торопитесь.Специально для вас я постараюсь найти эти пресловутые 10 отличий.


02 … Итак, Пермь, рано утром, -23 по Цельсию и 10 тестовых машин в разных комплектациях на разборки бывалым автожурналистам и любопытным блогерам. Я с любопытством смотрю на них. Ми-ДО — это второй Datsun, выпущенный для российского рынка. Первым был седан On-DO , который, кстати, уже показал отличные продажи в январе. Действительно, обе модели собираются на конвейере. Lada Kalina в Тольятти и являются плодом совместного сотрудничества AvtoVAZ и Nissan Motor Co., Ltd … Отмечу, что в большинстве случаев седаны мне нравятся больше, но этот хэтчбек выглядит явно круче, чем » старший брат». Не говоря уже о Калине, конечно. Посмотрите на его лицо — уже вполне современный, как говорится, «хищный» крой фар, хром, крупноячеистая решетка радиатора … Это и понятно, автором экстерьера mi-DO стал японский дизайнер Кодзи Нагано , покрасивший Nissan Murano, Infiniti fx м многие другие модели концерна Nissan .

03 … Читал, что в будущем на Калине планируют заменить передок на более современный, а пока предлагаю считать это первым отличием. Mi-DO однозначно привлекательнее внешне и спорить с этим глупо.

04 … В интерьере отличий меньше, но есть. В топовых комплектациях есть даже 7-дюймовый «телевизор». Он содержит навигацию, просмотр фото и видео, Bluetooth , USB и SD слот … Звучит, кстати, вполне. Естественно нужно немного подкрутить заводские настройки. Для двух предыдущих групп журналистов, тестирующих автомобили до нас, качество звука явно не имело значения, потому что все настройки были нулевыми. Мы с моим навигатором мартин добавили по вкусу максимумы и минимумы, и музыка стала действительно радостью.

05 … В базовой комплектации на Датсуны устанавливаются радиомодули двухдин. CD в ​​них некуда запихивать, но кроме магнитолы есть порт USB, Bluetooth и слот для SD карт.

06 … В той же базовой комплектации, которая стоит 415 тысяч рублей, к вашим услугам бортовой компьютер, отображающий кучу полезных данных, электрически регулируемые и подогреваемые боковые зеркала, подогрев передних сидений, электроусилитель руля, передний гидроусилитель. стеклоподъемники, две подушки безопасности, регулировка руля по высоте …

07 … … А вот за климат-контроль придется доплачивать 24 тысячи.


08.Добавлю к базовым опциям Datsuna за 415 тыс. ABS, а также BAS (усилитель экстренного торможения) и EBD (электронная система распределения тормозных сил). Я не очень понимаю эти сокращения, но дороги в Пермском крае зимой очень разные (в том числе крайне скользкие) и субъективно, если есть продуманная и опытная прослойка между рулем и передним сиденьем, можно почувствовать себя симпатично уверен в них с этой машиной. К тому же дорожный просвет в 174 мм позволяет машине не только ездить по асфальту, но и плавно выезжать с него.

09 … В общем по рулежке, по мне, не избалованной, есть только один серьезный недостаток. Субъективно, но все же. Педаль тормоза слишком туго затянута для моей правой ноги. Тем более в машине с автоматом, толкая в пермских пробках, приходилось прикладывать лишнее усилие на педаль, чтобы машина не катилась вперед. На нее действительно нужно оказывать давление.

10 … Но продолжим подсчет отличий. Базовая версия Калины предлагается за 377 тысяч рублей.Только в сравнении с тем же базовым Datsun стоимостью 415 тысяч, пусть и за дополнительную доплату 38 тысяч рублей, можно еще несколько пальцев согнуть, считая отличия: вторая подушка безопасности (жена не мужик что ли?), АБС, электропривод и подогрев зеркал, а также подогрев передних сидений, что, согласитесь, далеко не пустяковые навороты. Особенно, когда за окном лютый мороз.

11 … Но это еще не все. Продолжаем сгибать пальцы.Nissan перенастроил подвеску. Газонаполненные амортизаторы с низким сопротивлением, более жесткие пружины и усиленные стабилизаторы сделали шасси очень неприхотливым. За все время тест-драйва, несмотря на омерзительные пермские дороги после зимы, подвеску «пробить» не удалось.

12 … Кроме того, представители компании заявляют, что сделали дополнительную шумоизоляцию (капот, пол салона, багажник и колесные арки) и в по сравнению с Kalina, более комфортные акустические условия.В последнем, честно говоря, не довелось поехать (такси после гостей не в счет), но, в принципе, верю. Мы общались с Мартином, совершенно не напрягая голосовые связки, даже на большой скорости.

13 … Кстати, по поводу скорости. По трассе экземпляр с «автоматом» разгонялся до 165 км / ч. Максимум, судя по паспорту, составляет 170. Разгон до сотни заявлен 14,3 секунды на «автомате» и 12 секунд на «механике».

14 … В общем, хотелось бы отметить небольшую разницу в динамике между автомобилями с АКПП и МКПП. В моей практике был случай, когда «машина» вообще не ехала, портя впечатление от машины в целом. Пересев на копию с «ручкой», я все же убедился, что машина способна хоть как-то набирать скорость. Ну не в этом дело. Четырехступенчатый «автомат» устанавливается на Datsun Jatco (такой же ставится на Nissan note , Tiida и др.)). Переключается довольно шустро, правда немного ноет. Для тех, кому все-таки динамиков не хватает, есть кнопка O / D (Over Drive ).

15 … Двигатель ВАЗ восьмиклапанный, 1,6 л и всего 87 лошадиных сил. Однако крутящий момент 140 Нм обеспечивает приемлемую тягу на низких оборотах. Сами японцы, изучив двигатель, сочли его очень хорошим, но, конечно, немного улучшили. В частности, за счет более гибкого сильфона выхлопной системы и усиленного кронштейна рулевого вала инженеры победили «фирменную» вибрацию Калинова.

16 … В интернете пишут, что на диски mi-DO ставят резину Pirelli P1 Cinturato, но ни подтвердить, ни опровергнуть не могу. Тестовые автомобили имели шипованные шины Michelin .

17 … Расход топлива в смешанном цикле составляет 7 литров на сотню для «механики» и 7,7 для «автомата». Паспортные данные — увы, забыл посмотреть данные бортового компьютера.

18 … Немного о ТО и его стоимости. По заверениям представителей компании, нормо-часы обойдутся дешевле, чем легковые. Nissan , но при этом уровень сервиса обещан на порядок выше, чем привыкли владельцы Калина и Гранта, поскольку специалисты сервисного центра Datsun проходят обучение по программам и стандартам Nissan. Обещают около 7-8 тысяч за первое ТО. Кстати, ты забыл согнуть палец? Хорошее вежливое обслуживание — это всегда приятно.

19 … Несколько слов о позиционировании автомобиля. По крайней мере, так, как это видят маркетологи Datsun. В отличие от седана, хэтч позиционируется как машина для молодого человека, который покупает либо первую машину вообще, либо первую иномарку.

20 … Ну … Возражать нечего. Целевая аудитория подобрана правильно. Главное — дать страдающей молодежи возможности хотя бы для не глубокого тюнинга в виде различных хромированных накладок, альтернативной оптики и так далее.Может быть, что-нибудь из Индии или Индонезии, где Datsun тоже недавно реанимировали, подвезут. Кстати, я уже встречал в сети два клубных форума.

21 … Что ж, в конце обзора после стольких лестных слов в адрес хочется немного поворчать. Впрочем, вы сами все видите — багажник в этой машине практически отсутствует. Чтобы перевезти что-то крупнее пары рюкзаков, придется сложить задние сиденья (в соотношении 40/60).Хорошо, что туда влезает полноразмерная запаска.

22 … При этом задние сиденья вообще встык. Подхожу, но хотелось бы хотя бы пару сантиметров на переднее сиденье, так сказать, про запас. С другой стороны, чего я на самом деле хочу от машины B-класса? Кстати о креслах. В mi-DO установлены новые, поддерживающие и не такие рыхлые, как раньше, кресла с удлиненной подушкой. Правда только в «топовой» комплектации.

23 … В итоге хочу сказать следующее. Несмотря на указанные в посте отличия между и Калиной , эти отличия, конечно, не так велики. Для большего, так сказать, весомого успеха людям Datsun нужно не покладая рук продолжать улучшать свои машины, держать цены на них любые, извините за тавтологию, цену и не затягивать запуск третьей модели и лучше, если она недорогой кроссовер.Кроме китайцев других конкурентов за эти деньги практически нет, но и АвтоВАЗ все-таки не дремлет. Что купить — каждый решает сам. А пока мне нравится, как одна девушка написала на форуме клуба: « Они похожи, но мне лично не нравится морда Калины, и если за те же деньги предлагают« маленького японца », то почему бы не купить, чем куплю ВАЗ ?


Напоминаю копипастерам, что при перепечатке фото и текста актив ссылка на источник обязательна.Без noindex и nofollow .
Бумага и электронные носители должны быть

Описание BMW M3 E36. Описание BMW M3 E36 BMW M3 E36 седан

— установила высшую планку в классе спортивных гражданских автомобилей. А когда встал вопрос о смене поколения, все немного замерзли. Ведь очень мало примеров, когда наследник был лучше своего предшественника. Это как с фильмами, первая часть выйдет, а вторая в 99% случаев будет шлаком.Так и с автомобилями, они завоюют имя и начнут выпускать остатки старых двигателей и устаревших технологий.
BMW M3 E36 появился на рынке в 1992 году. Он был построен на базе E36. Но если присмотреться, то даже во внешности очень много изменений: более развитый передний спойлер, задний обвес, расширенные арки, более обтекаемые боковые зеркала, заниженная подвеска и многие другие изменения, не бросающиеся в глаза на первый взгляд.
BMW M3 E36 выпускался в разных кузовах: седан, купе, кабриолет (с мягким складным верхом, но он весил больше, стр.е. и был немного медленнее седана и купе).
Но в техническом плане от обычных трех осталось не так уж и много, а точнее почти ничего, BMW M3 E36 — просто еще одна машина.
Когда он впервые появился, журналисты были поражены и некоторые утверждали, что это лучшая машина.
Мотор был специально разработан для нее. Шестицилиндровый S50B30 имел 286 л.с. и 320 Нм. Не следует забывать, что в те годы у Порше и Феррари не всегда было одинаковое количество лошадей, а обычно меньше.С такой силовой установкой автомобиль разгонялся до сотни за 6 секунд.
А в 1995 году М3 претерпел рестайлинг, в ходе которого обновили и двигатель. S50B32 получил увеличенный объем, Double Vanos (уникальная разработка от BMW, система изменения фаз газораспределения, поскольку электроника автоматически изменяла характеристики впуска и выпуска, чтобы двигатель мог работать с максимальной эффективностью на всех скоростях). В результате мощность увеличилась до 350 Нм. Коробку передач заменили на шестиступенчатую.Разгон до сотни сократился до 5,5 секунды.
В 1997 году появилось новое поколение коробки передач — секвентальный SMG. Смысл его такой же, как и в исправной коробке, т.е. по сути это механическая коробка передач, но выжимать сцепление не нужно, это делает автомат. Это позволило увеличить скорость переключения передач до 0,15 секунды. Обычная коробка передач не может переключаться на этой скорости.
M3 отправился в Америку с пониженной мощностью до 240 л.с.
BMW M3 E36 также была усилена тормозная система, тормозные диски увеличены до 315 и 312 мм.Диски были 17-дюймовыми с шинами 235/40. После рестайлинга колеса стали широкими.
В салоне спидометр показал разметку на высокую максимальную скорость, а красная зона на тахометре перенесена дальше. Некоторые облицовочные панели теперь имеют фирменный триколор. Спортивное рулевое колесо и кресла с расширенной боковой поддержкой. Везде очень дорогие материалы и кожа.
BMW M3 GT E36 — гоночный автомобиль, выпущенный на омологацию. Всего было построено 350 штук.Мотор в нем был форсированный.
BMW M3-R E36 — Произведено 15 штук. Он выпускался для гоночных автомобилей и был разогнан до 325 л.с. У нее даже не было задних сидений.
BMW M3 GTR E36 — это экстремальный вариант, с минимумом опций, с каркасом безопасности, максимально облегченный (его вес 1300 кг), мощность двигателя 300 л.с.
В 1999 году прекратился выпуск BMW M3 E36. На смену ему пришел BMW M3 E46.

Действительно, легендарный, культовый и уважаемый во всем мире BMW m3 e36 собрал в свое время невероятное количество поклонников и почитателей.В то же время многие люди все еще мечтают или планируют купить именно эту модель вместо той, которую они водят сейчас. И это совершенно осознанный выбор. Почему? — Это просто, потому что, управляя этим автомобилем, вы входите в лучшее, вы будете быстрее многих на дороге, вам будет комфортно управлять автомобилем, а обслуживание автомобиля будет в пределах минимума по современным стандартам.

Характеристики e36 m от bmw

Выпускался с 1991 по 1998 год как часть спортивной модификации уже спортивной облегченной 3-серии E36.BMW M 3 внешне мало чем отличался от обычного BMW 3-й серии, хотя M3 E36 оснащен другими бамперами, выхлопной системой, зеркалами и фирменным знаком.

Чаще всего до состояния «М» относились купе и седаны. Проблемы с кузовами такие же, как и у обычных троек 90-х — это и понятно, ведь спортивная модификация предполагала доработанную ходовую часть — лошадиные силы и средство сдерживания этого стада под управлением водителя. Да и bmw 3 m performance переводится попросту как заряженная третья серия, а не отдельная модификация…

Двигатели

Основная изюминка этого автомобиля скрыта под его капотом, ведь здесь находится мощный двигатель объемом 3,0 литра (S50B30), крутящий момент которого составляет 320 Нм, а мощность — 286 л.с. В те времена немецкие инженеры создали идеальный для водителя BMW e36 m, те автомобили, в которых не было электроники, а все управление ложилось на плечи ответственного и толкового пилота, чего нельзя сказать о современных разработках, в том числе от Баварцы. BMW M3 90-х отличается отличной управляемостью, которая считается одной из лучших на планете.

Существует еще одна версия такой машины с двигателем 3,2 л (S50B30), мощность которого составляет 321 л.с. Такой BMW е36 м удивляет нетипичной для того времени динамикой. Разгон с места до 100 км / ч составляет всего 5,5 секунды. Именно эта версия (3,2 л) предназначалась для европейских стран, а модели с двигателями 3,0 л — для США. Его двигатель по техническим характеристикам напоминает старый, но добротный М50 (рядная шестерка). Немецкие инженеры изменили M50 и сделали его спортивным.Завод проделал все необходимые работы по настройке этого двигателя, в результате чего появился двигатель S50. В BMW 3 sport нельзя игнорировать звук двигателя. Именно в этой модели он поистине красивый и спортивный, что особенно радует на высоких оборотах.

Салон

Из особенностей — в салоне BMW 3 в пакете M, как правило, присутствуют спортивные сиденья, оборудованные боковой поддержкой, типовые для серии M надписи на сиденьях, спидометр с максимальной отметкой 280 км / ч. .

И конечно же, фотографии BMW M 3


Бонус — Отзывы владельцев BMW 3 в m пакете

Если не расписывать, а просто подвести итоги владельцев BMW m 3, то получится примерно следующее:
  • + отличная динамика;
  • +
  • отличная подвеска;
  • +
  • отличная управляемость;
  • + хорошая плавность хода;
  • + отличное качество немецких запчастей;
  • — плохая шумоизоляция;
  • — мало места для задних пассажиров;
  • — из-за заднего привода и переизбытка мощности зимой ездить не особо комфортно;
  • — топливо с большим расходом.

Цена машины

Пакет БМВ 3 м дороже обычных 36с. Цена зависит от многих компонентов, среди которых основными являются состояние автомобиля, год выпуска, регион покупки и т. Д. Купить BMW M 3 можно примерно за 7000 долларов, то же самое, но в обычной комплектации для 2,5 литра бэху можно легко найти за 5-6 тысяч.

Технические характеристики

Характеристика Значение
Модель автомобиля: Bmw
Модель автомобиля: M
Поколение автомобиля: M3 Coupe (E36)
Модификация: 3.2 (321 л.с.)
Тип кузова: Купе
Кол-во дверей: 2
Количество мест: 5
Длина: 4433 мм
Ширина: 1710
Высота: 1335 мм
Колесная база: 2710 мм
Колея передняя: 1422 мм
Колея задняя: 1438 мм
Дорожный просвет: 110 мм
Максимальный объем багажника:
Минимальный объем багажника: 405 л
Расположение двигателя: Спереди, продольно
Объем двигателя: 3201 см 3
Мощность: 321 ч.п.
При об / мин: 7400
Крутящий момент: 350/3250 Н * м
Система подачи: Распределенный впрыск
Наличие турбокомпрессора:
Газораспределительный механизм: dohc
Расположение цилиндров: Рядный
Количество цилиндров: 6
Диаметр цилиндра: 86.4 мм
Ход поршня: 91 мм
Степень сжатия: 11,3
Количество клапанов на цилиндр: 4
Топливо: АИ-98
Привод: Задний
Количество шестерен (мех): 6
Кол-во передач (авто):
Передаточное число главной пары: 3.23
Тип передней подвески: Поперечный рычаг
Тип задней подвески: Винтовая пружина
Передние тормоза: Дисковые вентилируемые
Задние тормоза: Диск
ABS: есть
Усилитель руля: Гидроусилитель
Тип рулевого управления: Зубчатая рейка
Максимальная скорость: 250 км / ч
Время разгона (0-100 км / ч): 5.5 с
Расход топлива по городу: 11,8 л / 100км
Расход топлива по трассе: 8,4 л / 100км
Расход топлива Смешанный цикл: 8,7 л / 100 км
Объем топливного бака: 62 л
Снаряженная масса: 1515 кг
Допустимая полная масса: 1930 кг

Второе поколение BMW M3 E36 появился в 1992 году как совершенно новый и совершенно другой автомобиль.Хотя BMW разработала новую модель в качестве отправной точки для успешного участия в автомобильных гонках, компания также придает большое значение повседневному использованию этого автомобиля, сочетая отличную динамику и, как следствие, удовольствие от вождения.

Пример тому — достаточно места на задних сиденьях, которое намного больше, чем в предыдущей модели.

Четырехдверный седан удовлетворил желания многих клиентов, желающих объединить компактный роскошный автомобиль со всей ДНК высокопроизводительного спортивного автомобиля.Проще говоря, четырехдверная модель была наиболее удачным сочетанием спортивных характеристик и качества повседневной езды. В дополнение к своим характеристикам, идентичным купе M3, седан также имел улучшенный интерьер с деревянной отделкой и кожаными сиденьями Nappa.

Учитывая эти качества, неудивительно, что новый M3 E36 вскоре покорил клиентов и средства массовой информации по всему миру, а также принес компании множество наград и титулов.

Новая модель основана на успешной модели и отличается от своей предшественницы рядом улучшений, таких как полностью окрашенные боковые пороги и новый дизайн переднего спойлера.

Дизайнеры сознательно отказались от широких колесных арок и большого заднего спойлера, что позволило автомобилю занять новую позицию на рынке.

На первый взгляд отличия M3 от серийной базы E36 заключаются в аэродинамическом оформлении внешних элементов, таких как передний и задний бамперы с выхлопной системой, наличие спортивных спойлеров, накладок, специальных колес и заднего вида. зеркала.

M3 E36, как и его предшественник, был доступен в нескольких спецификациях:

  • European
  • Южноафриканский
  • Североамериканский (,)

Двигатели

Вместо того, чтобы сосредоточиться на гоночном спортивном автомобиле, BMW M GmbH создала элегантный и сдержанный M3 со сверхмощной производительностью.

Таким образом, мощность и производительность M3 E36 с четырьмя клапанами на цилиндр обеспечивает на 46% больше мощности, чем его предшественник, в то время как ни один другой двигатель в мире не выдавал такой мощности — 95,5 л.с. на литр в 3-х литровой и 100,3 л. в версии 3,2 л.

Динамика

В итоге M3 Coupe разгоняется до 100 км / ч всего за 6,0 секунды, а максимальная скорость — 250 км / ч, а затем — была ограничена электроникой, так как компания решила добровольно применить это ограничение на всех дорожных версиях. .

Расход

Низкий расход топлива у M3 E36 в то время также был весьма примечателен, оставаясь на том же уровне, что и у моделей среднего класса — 9,1 литра топлива премиум-класса. И это был, конечно же, неэтилированный бензин, поскольку современные технологические катализаторы начали использовать в начале 90-х годов.

Инженеры BMW действительно модернизировали существующую технологию катализатора специально для нового двигателя, называемую в этом процессе лямбда-регулированием. В результате шестицилиндровый двигатель не только соответствовал стандартам выбросов CO2, но даже превышал предельные значения выбросов более чем на 50 процентов.

Размеры (редактировать)

Размеры указаны для моделей с 3,2-литровым двигателем.

размеры в мм Седан (4S) Купе (2S) Кабриолет (2CS)
Длина 4433 4433 4433
Ширина 1698 1710 1710
Высота 1365 1335 1340
Колесная база 2710 2710 2710
Колея передняя 1422 1422 1422
Колея задняя 1438 1438 1438
Клиренс 110 110 110
Размер передних шин 225/45 ZR 17 225/45 ZR 17 225/45 ZR 17
Размер задней шины 245/40 ZR 17 245/40 ZR 17 245/40 ZR 17
Снаряженная масса, кг 1460 1440 1560
Полная масса, кг 1950 1930 1980
Объем багажника, л 435 405 230

Шасси

Подвеска

M3 E36 со стойками переднего моста и усиленными пластинами рессоры и шарнирными пальцами, амортизаторами и стабилизаторами поперечной устойчивости, поперечной устойчивостью, задним мостом с центральной дугой (сначала установлена, что служит для уменьшения до минимума зазора при разгоне и торможении) был значительно улучшен.

Комплектация

BMW M3 E36 с самого начала оснащался очень мощными тормозами с большими вентилируемыми поворотными дисками. тормозные суппорты на передних и задних колесах … Антиблокировочная тормозная технология ABS, которая в то время являлась стандартной функцией каждого автомобиля BMW, была специально модифицирована для повышения выдающихся характеристик M3.

Четырехместный кабриолет M3 дебютировал в 1994 году с инновационной технологией безопасности при опрокидывании в стандартной комплектации. Эта система, представленная BMW в то время, предлагала всем пассажирам стандарты безопасности и защиты, которых раньше не было в автомобиле с открытым верхом.В сочетании с чрезвычайно жесткой рамой ветрового стекла две невидимые дуги за подголовниками задних сидений обеспечивают оптимальную защиту водителя и пассажиров в случае опрокидывания. Датчики управления положением автомобиля мгновенно активируют дуги с помощью пружин при достижении определенного предела положения автомобиля.

В 1997 году для M3 E36 транслируется автоматическая механическая коробка SMG, и в том же году было произведено обновление модельного ряда M3 — белые стеклянные поворотники стали стандартно на автомобиль, а в моторном отсеке The 3.0-литровый двигатель был заменен на уже упомянутый 3,2-литровый.

Немецкий автопроизводитель представил BMW M3 E36 в октябре 1992 года на Парижском автосалоне. С выпуском модели затягивать не стали, и уже в ноябре стартовали европейские продажи … Что интересно, эта «эмка» стала первой в истории серии моделью с шестицилиндровым двигателем.

Сначала модель была доступна только в облике купе, и только в 1994 году немцы представили версии седан и кабриолет, которые практически не отличались от оригинала.Так, седан получился чуть выше (на 30 мм), а кабриолет получил тканевый складной верх.

В длину, ширину и высоту BMW M3 E36 достигает 4432, 1796 и 1336 мм соответственно. Колесная база автомобиля составляет 2700 миллиметров. В снаряженном состоянии машина весит 1460 кг.

Средний расход топлива BMW M3 E36 при движении по городу, по данным производителя, составляет 16,0 л. Даже по современным меркам это достаточно хороший показатель, особенно если учесть, что «сердце» автомобиля — двигатель мощностью около 300 л.с.

В зависимости от версии M3 E36 комплектуется бензиновым агрегатом объемом 3,0 или 3,2 литра, развивающим мощность 286 или 321 л.с. соответственно. Двигатель работает в паре с пятиступенчатой ​​«механикой».

Независимо от типа двигателя максимальная скорость ограничена 250 км / ч. Но разгон до сотни — другое дело. Если с 3,0-литровым двигателем автомобиль разгоняется с места до сотни за 6,0 секунды, то с более мощной версией — за 5,4 секунды.

Чтобы обуздать машину на полной скорости, вам нужны правильные тормоза, и у M3 E36 они есть.Баварским специалистам удалось добиться впечатляющих результатов, благодаря которым полная остановка автомобиля со 100 км / ч до 0 км / ч занимает всего 2,8 секунды, а тормозной путь составляет около 35 метров.

Дизайн большинства автомобилей, выпущенных в 90-х годах прошлого века, сегодня выглядит устаревшим, но BMW M3 (E36) удалось избежать этой участи, и даже сейчас он выглядит вполне современно.

Во внешнем виде автомобиля нет ни одной лишней детали, но наибольшего внимания заслуживает передний бампер, задающий настроение.Его конструкция явно пришла из автоспорта. Он выглядит очень мощным и агрессивным.

Маленькие зеркала заднего вида дополняют внешний вид. Они выглядят очень забавно, а за счет их обтекаемой формы достигается лучшая аэродинамика.

Интерьер BMW M3 E36 выполнен в строгом классическом стиле, хотя и здесь есть нотки спортивности. Салон удобный, но без излишеств. То же можно сказать и о его оснащении — ведь у нас машина среднего класса.

Со временем модель обзавелась несколькими мелкосерийными «заряженными» модификациями. Итак, наибольшего интереса заслуживает версия BMW M3 GT E36. Автомобиль разгоняется до 295 л.с. двигатель, эксклюзивные 17-дюймовые колесные диски и уникальная цветовая схема British Racing Green. Всего было выпущено 350 экземпляров M3 GT E36.

Также стоит упомянуть гоночную версию модели M3 GTR E36. Автомобиль в этой модификации может похвастаться 300-сильным двигателем, расширенными колесными арками и 18-дюймовыми колесами.

Производство BMW M3 (E36) продолжалось до 1999 года, а вышеупомянутая версия с 3,2-литровым двигателем поступила в продажу только в 1995 году. Сначала немцы свернули производство седана, а затем сошли купе и кабриолет. сборочный конвейер. Сегодня машину можно купить на вторичном рынке по средней цене 500 000 рублей.

HD обои: осень, калина, америнканхейзи, ягоды, ваза, красный, металл

HD обои: осень, калина, америнканхейси, ягоды, ваза, красный, металл | Обои Flare Public Domain осень, калина, америнканхейзи, ягоды, ваза, красный, металл, HD обои Информация об оригинальных обоях: Размер изображения: 4272x2848px Размер файла: 1.13 МБ WallpaperFlare — это открытая платформа, на которой пользователи могут делиться своими любимыми обоями. Загружая эти обои, вы соглашаетесь с нашими Условиями использования и Политикой конфиденциальности. Если вы являетесь автором и обнаружите, что это изображение опубликовано без вашего разрешения, сообщите нам о нарушении закона США «Об авторском праве в цифровую эпоху» (DMCA), пожалуйста, свяжитесь с нами Выберите разрешение и загрузите эти обои

Загрузите эти обои в качестве рабочего стола ПК и ноутбука (включая разрешения 720P, 1080P, 2K, 4K, для обычных ПК и ноутбуков HP, Lenovo, Dell, Asus, Acer):

Загрузите эти обои как рабочий стол iMac:

iMac 21.5-дюймовый дисплей со светодиодной подсветкой:

1920×1080

Загрузите эти обои как рабочий стол MacBook:

MacBook Air 13 дюймов, MacBook Pro 15,4 дюйма:

Полный размер — 1440×900

MacBook Pro с дисплеем Retina 13,3 дюйма, MacBook Air с дисплеем Retina 13 дюймов, MacBook Air 13,3 дюйма (2020, M1):

2560×1600

Скачать эти обои как рабочий стол с двумя мониторами:

Скачать эти обои как рабочий стол на тройном мониторе:

Скачать эти обои как рабочий стол для четырех мониторов:

Загрузите эти обои как рабочий стол iPhone или экран блокировки:

iPhone 2G, iPhone 3G, iPhone 3GS:

320 x 480

iPhone 4, iPhone 4s:

640 x 960

iPhone 5, iPhone 5s, iPhone 5c, iPhone SE:

640×1136

iPhone 6, iPhone 6s, iPhone 7, iPhone 8:

750×1334

iPhone 6 plus, iPhone 6s plus, iPhone 7 plus, iPhone 8 plus:

1242×2208

iPhone X, iPhone Xs, iPhone 11 Pro:

1125×2436

iPhone Xs Max, iPhone 11 Pro Max:

1242×2688

iPhone Xr, iPhone 11:

828×1792

iPhone 12 mini, iPhone 13 mini:

1080×2340

iPhone 12, iPhone 12 Pro, iPhone 13, iPhone 13 Pro:

1170×2532

iPhone 12 Pro Max, iPhone 13 Pro Max:

1284×2778

Загрузите эти обои в качестве рабочего стола телефона Android или экрана блокировки (для обычных телефонов Samsung, Huawei, Xiaomi, Redmi, Oppo, Realme, Oneplus, Vivo, Tecno Android):

Загрузите эти обои как рабочий стол iPad или экран блокировки:

iPad, iPad 2, iPad Mini:

768×1024, 1024×768

iPad 3, iPad 4, iPad Air, iPad Air 2, iPad 2017 г., iPad Mini 2, iPad Mini 3, iPad Mini 4, 9.IPad Pro, 7 дюймов:

2048×1536, 1536×2048

iPad Pro 10,5 дюйма:

2224×1668, 1668×2224

iPad Pro 11 дюймов:

2388×1668, 1668×2388

iPad Pro 12,9 дюйма:

2732×2048, 2048×2732

iPad Air 10,9 дюйма:

2360×1640, 1640×2360

iPad 10,2 дюйма:

2160×1620, 1620×2160

iPad mini, 8,3 дюйма:

2266×1488, 1488×2266

Загрузите эти обои в качестве рабочего стола или экрана блокировки планшетов Surface и Android:

Похожие HD обои

  • 2560 Икс 1600 px

    Клубника свежая, красные ягоды, фрукты, корзина, клубника красная
  • 1920 г. Икс 1200 px

    Красный Король, алхимия, Бегемот (группа), экстрим-метал, черненый дэт-метал
  • 1920 г. Икс 1080 px

    различные фрукты, персики, клубника, абрикосы, вишня (продукты питания)
  • 2135 Икс 1600 px

    цветы, стол, корзина, лилии, ягода, ваза, натюрморт, смородина
  • 7360 Икс 4912 px

    Всеобщее достояние Клубника, ягода, ведро, зеленый, красный, клубника, фрукты, продукты питания
  • 4912 Икс 3264 px

    Еда, ягоды, ежевика, клубника, лето, малина, фрукты
  • 2560 Икс 1600 px

    фруктовое ассорти, фрукты, виноград, корзина, клубника, вишня
  • 5120 Икс 2880 px

    красные листья, осенние листья, листва, лист
  • 2800 Икс 2051 px

    Белый кожаный диван и оранжевые декоративные подушки, Интерьер, вазы
  • 1920 г. Икс 1080 px

    Фиолетовые пионы, украшение из розовых пионов, корзина, ваза, натюрморт
  • 9932 Икс 5528 px

    Фруктовое ассорти с корзиночкой, ягодами, малиной, яблоками, апельсинами
  • 6000 Икс 4220 px

    Красная роза; ваза из прозрачного стекла; книга; белое перо, старое, перо, стол
  • 3840 Икс 2160 px

    Корзина арбуза, ягоды, клубника, киви, фруктовый десерт
  • 2560 Икс 1600 px

    Красные яблоки, фрукты, корзина, яблоки
  • 1920 г. Икс 1200 px

    металл, ржавчина, красный цвет, текстура, фоны, полный кадр, текстурированный
  • 1920 г. Икс 1200 px

    красная основа с серой каймой цифровые обои, фон, текстура
  • 5946 Икс 4008 px

    гроздь вишни на белой плетеной чаше, Подарки, вишнево-красный, корзина
  • 2018 г. Икс 1214 px

    Букеты цветов Клубника, ваза, корзина, природа и пейзажи
  • 1920 г. Икс 1080 px

    таверна, дерево, солнечный свет, рисунок, стул, деревянная поверхность, корзины
  • 1920 г. Икс 1080 px

    красные листья, осенние листья, дерево, осенний пейзаж, листопадные
  • 1680 Икс 1050 px

    Фотография, Натюрморт, Яблоко, Корзина, Ягода, Лист, Ваза
  • 4200 Икс 2780 px

    розовые лепестковые цветы, розы, букеты, ваза, корзина, стол, сервиз
  • 2048 Икс 1365 px

    плоды черники, виноград, осень, листья, ягоды, виноградник, здоровое питание
  • 3000 Икс 2593 px

    пучок вишни и коричневая плетеная корзина, вишня, ягоды, свежие
  • 2709 Икс 2086 px

    красные и желтые цветы картина, картина, ваза, гвоздика, Гог, Винсент
  • 2560 Икс 1435 px

    корзины, ягоды, пища, грибы, еда и напитки, фрукты, здоровое питание
  • 2873 Икс 2160 px

    малина фото крупным планом, смешанная, ягода, черная, виноградная лоза
  • 2560 Икс 1600 px

    Красивая осень, лес, деревья, красные листья, трава, солнечные лучи, фото осенних деревьев днем ​​
  • 6016 Икс 4016 px

    Всеобщее достояние круглый венок на тему Хэллоуина на синей поверхности, осень, плоский
  • 1920 г. Икс 1200 px

    клубника, фрукты, красный, розовый, брызги, макро, еда, брызги
  • 3840 Икс 2160 px

    натуральные продукты, ягоды, малина, фрукты, замороженные, мороз, матовый
  • 1920 г. Икс 1440 px

    Гвоздики, розовые красные и белые цветы, ваза
  • 1920 г. Икс 1200 px

    Осень, природа, можжевельник, голубые ягоды, капли воды, ягоды черники
  • 2560 Икс 1675 px

    пища, красный цвет, корзины, фрукты, клубника, еда и напитки, клубника
  • 1920 г. Икс 1200 px

    Красные листья, веточки, осень, размытие фона
  • 2560 Икс 2050 г. px

    красная роза, красная клубника и корзина, клубника, контейнер
  • 5184 Икс 3456 px

    4k, autumn, blur, 5k, Viburnum, tree, 8k
  • 1920 г. Икс 1200 px

    Листья, осень, капли воды, желтый красный фиолетовый
  • 5120 Икс 2880 px

    рождество, красный цвет, елочный шар, елочные шары, деревянные доски, деревянный
  • 2048 Икс 1536 px

    женское красно-розовое платье с короткими рукавами, модель, подушка
  • 1920 г. Икс 1280 px

    красные плоды клубники, клубника, корзина, снег, зима, холодная температура
  • 1920 г. Икс 1080 px

    Природа, парк, осень, красные листья, осенний пейзаж HD
  • 1920 г. Икс 1080 px

    красный лес, осень, природа, дорога, дерево, листья, древесные растения
  • 1600 Икс 900 px

    цифровые обои коричневая пуля, Гравитация, Metal Gear Solid V: The Phantom Pain
  • 1600 Икс 1220 px

    белый тюльпан цветочная композиция, тюльпаны, цветы, ваза, корзина
  • 1920 г. Икс 1200 px

    Япония, домик, дерево, красные листья, осень
  • 1920 г. Икс 1080 px

    черно-красный логотип Rip and Tear пока не будет сделано, Doom 4, Doom (игра)
  • 2560 Икс 1682 px

    пища, красный цвет, ягоды, эскимо
  • 5184 Икс 3180 px

    красный BMW E46 седан, вид сбоку, листва, осень, автомобиль, моторный транспорт
  • 5530 Икс 3687 px

    ванильное мороженое с малиной, черникой и клубникой
Загрузка обоев

Chevrolet Cruze (седан): Обзор модели 2014-2015

Chevrolet Cruze (седан) впервые был представлен миру автомобилистов в 2008 году.Презентация прошла во Франции в Парижском салоне. Новую модель сразу же оценили. Практически одновременно с этим седан начали продавать в Южной Корее. Однако здесь он был представлен под названием Daewoo Lacetti Premiere. Автомобиль производился на платформе Delta II. Дизайн и характеристики новой модели были настолько впечатляющими, что General Motors отказалась производить сразу две марки: Cobalt и Lacetti.

Глядя на фото Шевроле Круз (седан) видно, что автомобиль оснащен параметрами, соответствующими С-классу.Он достигает 4603 мм в длину, 1477 мм в высоту и 1787 мм в ширину. Багажник достаточно вместительный, чтобы доработать седан, его объем составляет 450 литров. Величина клиренса (клиренса) — 150 мм.

Очертания Chevrolet Cruze приобрели некоторую дерзость, что полностью соответствует современным тенденциям. Безвозвратно исчезли классические и спокойные формы.

2014 Chevrolet Cruze Sedan

Выпущенный в 2014 году седан, оснащенный достаточно мощным двигателем. Возможны варианты использования агрегата, объемом 1.8 литров при емкости 138 л. из. и с турбонаддувом 1,4 л при мощности 130 л. из. Также стал устанавливаться 2-литровый дизель модели Jetta TDI. В этих агрегатах улучшены системы охлаждения и подачи топлива. Мощность достаточно большая — 150 л. из.

Механической трансмиссией комплектуется только Шевроле Круз (седан) с бензиновым двигателем, у него 6 скоростей. Автоматическая коробка передач предназначена для дизельных двигателей. Он комбинированный, 6-ступенчатый.





Комплектация седан 2014 года

Chevrolet Cruze 2014 представлен в 4 типах комплектации:

  • LT. Здесь модель оснащена модернизированным двигателем 1.4, 7-дюймовым сенсорным экраном, Bluetooth, круиз-контролем, 16-дюймовыми алюминиевыми легкосплавными дисками, кожаным рулевым колесом, голосовым управлением и камерой заднего вида.
  • LS. В комплектацию входит хорошая аудиосистема с 6 динамиками, кондиционер, 16-дюймовые высокопрочные стальные колеса, телескопическое рулевое управление, бортовой компьютер и спутниковое радио.Также автомобиль укомплектован полным электропакетом и регулируемыми сиденьями.
  • Eco Данная опция представлена ​​усиленной колесной базой, кожаной обивкой салона, навигационной системой, спортивной подвеской. Топливный бак в этой конфигурации значительно уменьшен. Автомобиль укомплектован мощной аудиосистемой Pioneer.
  • LTZ. Такая комплектация подразумевает наличие подогрева зеркал и сидений, автоматического запуска двигателя (без ключа), 17-дюймовых колес, саморегулирующейся системы климат-контроля и заднего спойлера.

Также стоит обратить внимание на следующие моменты штатной комплектации. Прежде всего, седан Chevrolet Cruze (цена варьируется от 17000 до 22000 долларов) оснащен системой OnStar. Он автоматически сообщает об аварийных ситуациях. За безопасность при парковке и в слепых зонах на протяжении всего движения отвечают специальные датчики. Усиленный кузов, антиблокировочная система тормозов, система контроля устойчивости, сигнализация, подушки безопасности и дистанционные замки дверей входят в стандартную комплектацию.

2015 Chevrolet Cruze Sedan: второе поколение

В 2015 году был представлен седан второго поколения суперпопулярной модели Chevrolet Cruze, которая сейчас строится на новой платформе американского концерна General Motors — D2. Полностью обновлен тюнинг «Шевроле Круз» (седан). Причем модификации для американского рынка и остального мира отличаются от автомобилей, которые предназначены для продажи в Китае.

Первая лобовая часть выглядит довольно агрессивно: зауженные узкие фары, огромный воздухозаборник в нижней части бампера, а также узкая фальш-решетка радиатора.Все ключевые элементы отделаны хромом. Профиль тела заполнен множеством пересекающихся друг с другом линий. Это значительно добавляет внешнему виду громоздкости и экстравагантности. Фото «Шевроле Круз» (седан) демонстрирует ярко выраженную солидность, по сравнению с предшественником. Поднимающаяся боковая линия бокового остекления добавляет образу стремительности и спортивности. Сзади бросаются в глаза плавные очертания заднего бампера и большие блоки оптических фонарей. Все гармонично и продуманно.Стоит отметить, что и в головной, и в задней оптике есть светодиодные секции, которые отличаются экономичным потреблением электроэнергии, а также впечатляющей яркостью.

Седан 2015 модельного года, разработанный для рынка КНР, имеет простой экстерьер спереди, но более четкие линии при взгляде сбоку. Ценовая политика такой машины — около 20 000 долларов.



Характеристики салона

Салон «Шевроле Круз» (седан) в обеих версиях практически идентичен. Его концепция осталась прежней, но разработчики полностью переработали приборную панель, рулевое колесо, а также центральную консоль.Интересную форму получили боковые дефлекторы воздуха. В центре консоли, традиционно для современных автомобилей, расположен большой дисплей мультимедийной системы MyLink. Последний позволяет водителю получить доступ к глобальной сети через 3G и 4G. Кроме того, он поддерживает Android Auto и Car Play. Дисплей системы может иметь диагональ 7 или 8 дюймов.



Размеры и технические характеристики: седан Chevrolet Cruze 2015

Если говорить о габаритах, то колесная база автомобиля увеличилась незначительно — на 1.5 см. Длина увеличилась на 6,9 см. Благодаря использованию совершенно нового шасси, вес автомобиля уменьшился. Помимо прочего, создателям удалось на 27% увеличить жесткость кузова.

Передняя подвеска автомобиля Шевроле Круз (седан) — классический Макферсон, а задняя подвеска — на торсионной балке. Базовым агрегатом для автомобиля был двигатель с турбонаддувом объемом 1400 куб. См, способный развивать впечатляющие 153 литра. из. С ним агрегатируется механическая 6-ступенчатая или аналогичная автоматическая коробка передач.Благодаря такому мотору и уменьшению веса разгон до первой «сотни» у Cruze 2-го поколения занимает не более 8 секунд. В то же время агрегат демонстрирует скромный расход. Так, при движении по трассе можно уложиться в 5,8 л на 100 км. Машина оснащена системой старт / стоп, повышающей эффективность.

Данные и контактная информация аэропорта

Используйте эту форму, чтобы найти основные средства обслуживания и контактную информацию аэропорта, загружаемые данные и списки аэропортов с планом действий в чрезвычайных ситуациях.Используйте ссылки в итоговых отчетах, чтобы просмотреть более полные данные и распечатать формы основных записей аэропорта (5010-1).

Информация по состоянию на 09.09.2021


Предупреждение: ПЕРЕХОД НА ПОРТАЛ ДАННЫХ И ИНФОРМАЦИИ АЭРОПОРТА

Всем пользователям этого сайта предлагается начать пользоваться порталом данных и информации аэропорта. Все подписки на этот сайт в конечном итоге будут перемещены на портал, а этот сайт удален.

Форма выбора местоположения

FAA регион: ВСЕ ФАА РЕГИОНАЛЬНЫЙ САЛАСКАНЦЕНТРАЛЬНЫЙ ОЗЕРНО-ЗЕРНЫЕ ОЗЕРА НОВАЯ АНГЛИЯ СЕВЕРО-ЗАПАД ГОРЮЮЖЬЮЮЗ-ЗАПАДНО-ТИХООКЕАНСКИЙ ДИАПАЗОН

Район аэропортов: ВСЕ DISTRICTSALASKAN REGIONCENTRAL REGIONNEW АНГЛИЯ REGIONARKANSAS / ОКЛАХОМА ADOATLANTA ADOBECKLEY ADOBISMARCK ADOCHICAGO ADODENVER ADODETROIT ADOHARRISBURG ADOHELENA ADOHONOLULU ADOJACKSON ADOLOS АНДЖЕЛЕС ADOLOUISIANA / NEW МЕКСИКА ADOMEMPHIS ADOMINNEAPOLIS ADONEW YORK ADOORLANDO ADOARIZONASEATTLE ADOSAN ФРАНЦИСКО ADOTEXAS ADOWASHINGTON D.C. ADO

Состояние: ВСЕ ШТАТ. О COLUMBIADELAWAREFLORIDAGEORGIAGUAMHAWAIIIOWAIDAHOILLINOISINDIANAKANSASKENTUCKYLOUISIANAMASSACHUSETTSMARYLANDMAINEMICHIGANMINNESOTAMISSOURIN МАРИАНА ISLANDSMISSISSIPPIMONTANANORTH CAROLINANORTH DAKOTANEBRASKANEW HAMPSHIRENEW JERSEYNEW MEXICONEVADANEW YORKOHIOOKLAHOMAOREGONPENNSYLVANIAPUERTO RICOMIDWAY ISLANDSWAKE ISLANDRHODE ISLANDSOUTH CAROLINASOUTH DAKOTATENNESSEETEXASUTAHVIRGINIAVIRGIN ISLANDSVERMONTWASHINGTONWISCONSINWEST VIRGINIAWYOMINGPALMYRA АТОЛЛ

Округ: ВСЕ COUNTIESABBEVILLEACADIAACCOMACKADAADAIRADAMSADDISONAIKENAITKINALACHUAALAMANCEALAMEDAALAMOSAALBANYALBEMARLEALBERTA, CANADAALCONAALCORNALEUTIAN ISLANDSALEUTIANS EASTALEUTIANS WESTALEXANDERALEXANDRIAALFALFAALGERALLAMAKEEALLEGANALLEGANYALLEGHANYALLEGHENYALLENALLENDALEALPENAALPINEAMADORAMELIAAMERICAN SAMOAAMHERSTAMITEANCHORAGEANDERSONANDREWANDREWSANDROSCOGGINANGELINAANGOONANGUILLAANNE ARUNDELANOKAANSONANTELOPEANTRIMAPACHEAPPANOOSEAPPLINGAPPOMATTOXARANSASARAPAHOEARCHERARCHULETAARKANSASARLINGTONARMSTRONGAROOSTOOKASCENSIONASHEASHLANDASHLEYASHTABULAASOTINASSUMPTIONATASCOSAATCHISONATHENSATLANTICATOKAATTALAAUDRAINAUDUBONAUGLAIZEAUGUSTAAURORAAUSTINAUTAUGAAVERYAVOYELLESB.С., CANADABACABACONBAHAMASBAILEYBAKERBALDWINBALTIMOREBAMBERGBANDERABANNOCKBARAGABARBERBARBOURBARNESBARNSTABLEBARNWELLBARRENBARRONBARROWBARRYBARTHOLOMEWBARTONBARTOWBASTROPBATESBATHBAXTERBAYBAYFIELDBAYLORBEADLEBEAR LAKEBEAUFORTBEAUREGARDBEAVERBEAVERHEADBECKERBECKHAMBEDFORDBEEBELKNAPBELLBELMONTBELTRAMIBEN HILLBENEWAHBENNETTBENNINGTONBENSONBENTBENTONBENZIEBERGENBERKELEYBERKSBERKSHIREBERMUDABERNALILLOBERRIENBERTIEBETHELBEXARBIBBBIENVILLEBIG HORNBIG STONEBILLINGSBINGHAMBLACK HAWKBLACKFORDBLADENBLAINEBLAIRBLANCOBLECKLEYBLEDSOEBLOUNTBLUE EARTHBOISEBOLIVARBOLLINGERBON HOMMEBONDBONNERBONNEVILLEBOONEBOSQUEBOSSIERBOTETOURTBOTTINEAUBOULDERBOUNDARYBOURBONBOWIEBOWMANBOX BUTTEBOX ELDERBOYDBOYLEBRADFORDBRADLEYBRANCHBRANTLEYBRAXTONBRAZORIABRAZOSBREATHITTBRECKINRIDGEBREMERBREVARDBREWSTERBRISCOEBRISTOLBRISTOL BAYBRITISH ИНДИЙСКИЙ OCEANBROADWATERBRONXBROOKEBROOKINGSBROOKSBROOMEBROWARDBROWNBRULEBRUNSWICKBRYANBUCHANANBUCKINGHAMBUCKSBUENA VISTABUFFALOBULLITTBULLOCHBULLOCKBUNCOMBEBUREAUBURKEBURLEIGHBURLESONBURLIN GTONBURNETBURNETTBURTBUTLERBUTTEBUTTSCABARRUSCABELLCACHECADDOCALAVERASCALCASIEUCALDWELLCALEDONIACALHOUNCALLAHANCALLAWAYCALLOWAYCALUMETCALVERTCAMASCAMBRIACAMDENCAMERONCAMPCAMPBELLCANADIANCANDLERCANYONCAPE GIRARDEAUCAPE MAYCARBONCARIBOUCARLISLECARLTONCAROLINECARROLLCARSONCARSON CITYCARTERCARTERETCARVERCASCADECASEYCASSCASSIACASTROCASWELLCATAHOULACATAWBACATOOSACATRONCATTARAUGUSCAVALIERCAYUGACECILCEDARCENTRECERRO GORDOCHAFFEECHAMBERSCHAMPAIGNCHARITONCHARLESCHARLES CITYCHARLES MIXCHARLESTONCHARLEVOIXCHARLOTTECHARLTONCHASECHATHAMCHATTAHOOCHEECHATTOOGACHAUTAUQUACHAVESCHEATHAMCHEBOYGANCHELANCHEMUNGCHENANGOCHEROKEECHERRYCHESAPEAKECHESHIRECHESTERCHESTERFIELDCHEYENNECHICKASAWCHICOTCHILDRESSCHILTONCHIPPEWACHISAGOCHITTENDENCHOCTAWCHOUTEAUCHOWANCHRISTIANCHURCHILLCIBOLACIMARRONCITRUSCLACKAMASCLAIBORNECLALLAMCLARECLARENDONCLARIONCLARKCLARKECLATSOPCLAYCLAYTONCLEAR CREEKCLEARFIELDCLEARWATERCLEBURNECLERMONTCLEVELANDCLINCHCLINTONCLOUDCOAHOMACOALCOBBCOCHISECOCHRANCOCKECOCONINOCODINGTONCOFFEECOFFEYCOLBERTCOL ECOLEMANCOLESCOLFAXCOLLETONCOLLIERCOLLINCOLLINGSWORTHCOLORADOCOLQUITTCOLUMBIACOLUMBIANACOLUMBUSCOLUSACOMALCOMANCHECONCORDIACONECUHCONTRA COSTACONVERSECONWAYCOOKCOOKECOOPERCOOSCOPIAHCORDOVA-MCCARTHYCORSONCORTLANDCORYELLCOSHOCTONCOSTILLACOTTLECOTTONCOTTONWOODCOVINGTONCOWETACOWLEYCOWLITZCRAIGCRAIGHEADCRANECRAVENCRAWFORDCREEKCRENSHAWCRISPCRITTENDENCROCKETTCROOKCROSBYCROSSCROW WINGCROWLEYCULBERSONCULLMANCULPEPERCUMBERLANDCURRITUCKCURRYCUSTERCUYAHOGADADEDAGGETTDAKOTADALEDALLAMDALLASDANEDANIELSDANVILLEDAREDARKEDARLINGTONDAUPHINDAVIDSONDAVIEDAVIESSDAVISDAVISONDAWESDAWSONDAYDE BACADE KALBDE SOTODE WITTDEAF SMITHDEARBORNDECATURDEER LODGEDEFIANCEDEL NORTEDELAWAREDELTADENALIDENTDENTONDENVERDES MOINESDESCHUTESDESHADEUELDEWEYDICKENSDICKENSONDICKEYDICKINSONDICKSONDILLINGHAMDILLONDIMMITDINWIDDIEDIVIDEDIXIEDODDRIDGEDODGEDOLORESDONA ANADONIPHANDONLEYDOOLYDOORDORCHESTERDOUGHERTYDOUGLASDREWDU PAGEDUBOISDUBUQUEDUCHESNEDUKESDUNDYDUNKLINDUNNDUPLINDURHAMDUTCHESSDUVALDYEREAGLEEARLYEAST BATON ROUGEEAST CARROLLE АСТ FELICIANAEASTLANDEATONEAU CLAIREECTOREDDYEDGAREDGECOMBEEDGEFIELDEDMONSONEDMUNDSEDWARDSEFFINGHAMEL DORADOEL PASOELBERTELKELKHARTELKOELLISELLSWORTHELMOREEMANUELEMERYEMMETEMMONSERATHERIEESCAMBIAESMERALDAESSEXETOWAHEUREKAEVANGELINEEVANSFAIRBANKS NORTH STARFAIRFAXFAIRFIELDFALL RIVERFALLONFALLSFANNINFARIBAULTFAULKFAULKNERFAUQUIERFAYETTEFED STS MICRONESIAFENTRESSFERGUSFERRYFILLMOREFINNEYFISHERFLAGLERFLATHEADFLEMINGFLORENCEFLOYDFOARDFOND DU LACFORDFORESTFORRESTFORSYTHFORT BENDFOSTERFOUNTAINFRANKLINFREDERICKFREEBORNFREESTONEFREMONTFRESNOFRIOFRONTIERFULTONFURNASGADSDENGAGEGAINESGALLATINGALLIAGALVESTONGARDENGARFIELDGARLANDGARRARDGARRETTGARVINGARZAGASCONADEGASTONGATESGEARYGEAUGAGEMGENESEEGENEVAGENTRYGEORGEGEORGETOWNGIBSONGILAGILCHRISTGILESGILLESPIEGILLIAMGILMERGILPINGLACIERGLADESGLADWINGLASSCOCKGLENNGLOUCESTERGLYNNGOGEBICGOLDEN VALLEYGOLIADGONZALESGOOCHLANDGOODHUEGOODINGGORDONGOSHENGOSPERGOVEGRADYGRAFTONGRAHAMGRAINGERGRANDGRAND FORKSGRAND ISLEGRAND TRAVERSEGRANITEGRANTGRANVILLEGRATIOTGRAVESGRA YGRAYS HARBORGRAYSONGREELEYGREENGREEN LAKEGREENBRIERGREENEGREENLANDGREENLEEGREENSVILLEGREENUPGREENVILLEGREENWOODGREERGREGGGREGORYGRENADAGRIGGSGRIMESGRUNDYGUADALUPEGUAMGUERNSEYGUILFORDGULFGUNNISONGUTHRIEGWINNETTHAAKONHABERSHAMHAINESHALEHALIFAXHALLHAMBLENHAMILTONHAMLINHAMPDENHAMPSHIREHAMPTONHANCOCKHANDHANOVERHANSFORDHARALSONHARDEEHARDEMANHARDINHARDINGHARFORDHARLANHARMONHARNETTHARNEYHARPERHARRISHARRISONHARRISONBURGHARTHARTFORDHARTLEYHARVEYHASKELLHAWAIIHAWKINSHAYESHAYSHAYWOODHEARDHEMPHILLHEMPSTEADHENDERSONHENDRICKSHENDRYHENNEPINHENRICOHENRYHERKIMERHERNANDOHERTFORDHETTINGERHICKMANHICKORYHIDALGOHIGHLANDHIGHLANDSHILLHILLSBOROUGHHILLSDALEHINDSHINSDALEHITCHCOCKHOCKINGHOCKLEYHODGEMANHOKEHOLMESHOLTHONOLULUHOODHOOD RIVERHOOKERHOPEWELLHOPKINSHORRYHOT SPRINGHOT SPRINGSHOUGHTONHOUSTONHOWARDHOWELLHUBBARDHUDSONHUDSPETHHUERFANOHUGHESHUMBOLDTHUMPHREYSHUNTHUNTERDONHUNTINGDONHUNTINGTONHURONHUTCHINSONHYDEIBERIAIBERVILLEIDAIDAHOIMPERIALINDEPENDENCEINDIAN RIVERINDIANAINGHAMINYOIONIAIOSCOIOWAIREDELLIRIONIRONIR OQUOISIRWINISABELLAISANTIISLANDISLE ИЗ WIGHTISSAQUENAITASCAITAWAMBAIZARDJACKJACKSONJAMES CITYJASPERJAYJEFF DAVISJEFFERSONJEFFERSON DAVISJENKINSJENNINGSJERAULDJEROMEJERSEYJESSAMINEJEWELLJIM HOGGJIM WELLSJO DAVIESSJOHNSONJOHNSTONJONESJOSEPHINEJUABJUDITH BASINJUNEAUJUNIATAKALAMAZOOKALAWAOKALKASKAKANABECKANAWHAKANDIYOHIKANEKANKAKEEKARNESKAUAIKAUFMANKAYKEARNEYKEARNYKEITHKENAI PENINSULAKENAI-COOK INLETKENDALLKENEDYKENNEBECKENOSHAKENTKENTONKEOKUKKERNKERRKERSHAWKETCHIKAN GATEWAYKEWAUNEEKIDDERKIMBALLKIMBLEKINGKING И QUEENKING GEORGEKING WILLIAMKINGFISHERKINGMANKINGSKINGSBURYKINNEYKIOWAKIT CARSONKITSAPKITTITASKITTSONKLAMATHKLEBERGKLICKITATKNOXKOBUKKODIAK ISLANDKOOCHICHINGKOOTENAIKOSCIUSKOKOSSUTHKUSILVAKKUSKOKWIMLA CROSSELA MOURELA пазла PLATALA Портелы SALLELABETTELAC QUI PARLELACKAWANNALACLEDELAFAYETTELAFOURCHELAGRANGELAKELAKE И PENINSULALAKE О WOODSLAMARLAMBLAMOILLELAMPASASLANCASTERLANDERLANELANGLADELAPEERLARAMIELARIMERLARUELAS ANIMASLASSENLATAHLATIMERLAUDERDALELAURELLAURENSLAVACALAWR ENCELE FLORELE SUEURLEALEAKELEAVENWORTHLEBANONLEELEELANAULEFLORELEHIGHLEMHILENAWEELENOIRLEONLESLIELETCHERLEVYLEWISLEWIS И CLARKLEXINGTONLIBERTYLICKINGLIMESTONELINCOLNLINNLIPSCOMBLITCHFIELDLITTLE RIVERLIVE OAKLIVINGSTONLLANOLOGANLONOKELORAINLOS ALAMOSLOS ANGELESLOUDONLOUDOUNLOUISALOVELOWNDESLUBBOCKLUCASLUCELUMPKINLUNALUNENBURGLUZERNELYCOMINGLYMANLYNCHBURGLYNNLYONMACKINACMACOMBMACONMACOUPINMADERAMADISONMAHASKAMAHNOMENMAHONINGMAJORMALHEURMANATEEMANISTEEMANITOBA, CANADAMANITOWOCMARATHONMARENGOMARICOPAMARIESMARINMARINETTEMARIONMARIPOSAMARLBOROMARQUETTEMARSHALLMARSHALL ISLANDSMARTINMASONMASSACMATAGORDAMATANUSKA-SUSITNAMATHEWSMAUIMAURYMAVERICKMAYESMC CLAINMC CONEMC CORMICKMC CRACKENMC CREARYMC CULLOCHMC CURTAINMC DONALDMC DONOUGHMC DOWELLMC DUFFIEMC HENRYMC INTOSHMC KEANMC KENZIEMC KINLEYMC LEANMC LENNANMC LEODMC MINNMC MULLENMC NAIRYMC PHERSONMEADEMEAGHERMECKLENBURGMECOSTAMEDINAMEEKERMEIGSMELLETTEMENARDMENDOCINOMENOMINEEMERCEDMERCERMERIWETHERMERRICKMERRIMACKMESAMIAMIMIDDLESEXMIDLANDMIDWAY ISLANDSMIFFLINMILAMMILLARDMILLE LACSMILLERMILLSMILWAUKEEMINERMINERALMINGOMINIDOKAMINNEHAHAMISSAUKEEMISSISSIPPIMISSOULAMITCHELLMOBILEMODOCMOFFATMOHAVEMONITEAUMONMOUTHMONOMONONAMONONGALIAMONROEMONTAGUEMONTCALMMONTEREYMONTEZUMAMONTGOMERYMONTMORENCYMONTOURMONTROSEMOODYMOOREMOREHOUSEMORGANMORRILLMORRISMORRISONMORROWMORTONMOULTRIEMOUNTRAILMOWERMUHLENBERGMULTNOMAHMURRAYMUSCATINEMUSCOGEEMUSKEGONMUSKINGUMMUSKOGEEMUSSELSHELLNACOGDOCHESNANCENANSEMONDNANTUCKETNAPANASHNASSAUNATCHITOCHESNATRONANAVAJONAVARRONELSONNEMAHANEOSHONESHOBANESSNETHERLANDS ANTILLESNEVADANEW Брансуик, CANADANEW CASTLENEW HANOVERNEW HAVENNEW KENTNEW LONDONNEW MADRIDNEW YORKNEWAYGONEWBERRYNEWPORTNEWPORT NEWSNEWTONNEZ PERCENIAGARANICHOLASNICOLLETNIOBRARANOBLENOBLESNODAWAYNOLANNOMENORFOLKNORMANNORTH SLOPENORTHAMPTONNORTHERN MARIANA ISNORTHUMBERLANDNORTHWEST ARCTICNORTHWEST TERR, CANADANORTONNOTTOWAYNOVA SCOTIA, CANADANOWATANOXUBEENUCKOLLSNUECESNYEO BRIENOAKLANDOBIONOCEANOCEANAOCHILTREEOCONEEOCONTOOGEMAWOGLEOGLETHORPEOHIOOKALOOSAOK ANOGANOKEECHOBEEOKFUSKEEOKLAHOMAOKMULGEEOKTIBBEHAOLDHAMOLMSTEDONEIDAONONDAGAONSLOWONTARIOONTARIO, CANADAONTONAGONORANGEORANGEBURGOREGONORLEANSOSAGEOSBORNEOSCEOLAOSCODAOSWEGOOTEROOTOEOTSEGOOTTAWAOTTER TAILOUACHITAOURAYOUTAGAMIEOVERTONOWENOWYHEEOXFORDOZARKOZAUKEEP.Э.И., CANADAPACIFICPAGEPALAUPALM BEACHPALO ALTOPALO PINTOPAMLICOPANOLAPARKPARKEPARKERPARMERPASCOPASQUOTANKPASSAICPATRICKPAULDINGPAWNEEPAYETTEPAYNEPEACHPEARL RIVERPECOSPEMBINAPEMISCOTPEND OREILLEPENDERPENDLETONPENNINGTONPENOBSCOTPEORIAPEPINPERKINSPERQUIMANSPERRYPERSHINGPERSONPETTISPHELPSPHILADELPHIAPHILLIPSPIATTPICKAWAYPICKENSPIERCEPIKEPIMAPINALPINEPINELLASPIPESTONEPISCATAQUISPITKINPITTPITTSBURGPITTSYLVANIAPIUTEPLACERPLAQUEMINESPLATTEPLEASANTSPLUMASPLYMOUTHPOCAHONTASPOINSETTPOINTE COUPEEPOLKPONDERAPONTOTOCPOPEPORTAGEPORTERPORTSMOUTHPOSEYPOTTAWATOMIEPOTTAWATTAMIEPOTTERPOWDER RIVERPOWELLPOWERPOWESHIEKPOWHATANPRAIRIEPRATTPREBLEPRENTISSPRESIDIOPRESQUE ISLEPRESTONPRICEPRINCE EDWARDPRINCE GEORGEPRINCE GEORGESPRINCE OF WALESPRINCE WILLIAMPROVIDENCEPROWERSPUEBLO — ПУЭРТО RICOPULASKIPUSHMATAHAPUTNAMQUAYQUEBEC, CANADAQUEEN ANNESQUEENSQUITMANRABUNRACINERAINSRALEIGHRALLSRAMSEYRANDALLRANDOLPHRANKINRANSOMRAPIDESRAVALLIRAWLINSRAYREAGANREALRED LAKERED RIVERRED WILLOWREDWOODREEVESREFUGIORENORENSSELAERREN VILLEREPUBLICREYNOLDSRHEARICERICHARDSONRICHLANDRICHMONDRILEYRINGGOLDRIO ARRIBARIO BLANCORIO GRANDERIPLEYRIVERSIDEROANEROANOKEROBERTSROBERTSONROBESONROCKROCK ISLANDROCKBRIDGEROCKCASTLEROCKDALEROCKINGHAMROCKLANDROCKWALLROGER MILLSROGERSROLETTEROOKSROOSEVELTROSCOMMONROSEAUROSEBUDROSSROUTTROWANRUNNELSRUSHRUSKRUSSELLRUTHERFORDRUTLANDSABINESACSACRAMENTOSAGADAHOCSAGINAWSAGUACHESAINT HELENASAINT MARTINSALEMSALINESALT LAKESALUDASAMPSONSAN AUGUSTINESAN BENITOSAN BERNARDINOSAN ДиегоСан FRANCISCOSAN JACINTOSAN JOAQUINSAN JUANSAN ЛУИС OBISPOSAN MATEOSAN MIGUELSAN PATRICIOSAN SABASANBORNSANDERSSANDOVALSANDUSKYSANGAMONSANILACSANPETESANTA BARBARASANTA CLARASANTA CRUZSANTA FESANTA ROSASARASOTASARATOGASARGENTSARPYSAUKSAUNDERSSAWYERSCHENECTADYSCHLEICHERSCHOHARIESCHOOLCRAFTSCHUYLERSCHUYLKILLSCIOTOSCOTLANDSCOTTSCOTTS BLUFFSCREVENSCURRYSEARCYSEBASTIANSEDGWICKSEMINOLESENECASEQUATCHIESEQUOYAHSEVIERSEWARDSHACKELFORDSHANNONSHARKEYSHARPSHASTASHAWANOSHAWNEESHEBOYGANSHELBYSHENANDOAHSHERBURNESHERIDANSHERMANSHIAWASS EESHOSHONESIBLEYSIERRASILVER BOWSIMPSONSIOUXSISKIYOUSITKASKAGITSKAGWAY-Hoonah-ANGOONSKAGWAY-YAKUTATSKAMANIASLOPESMITHSMYTHSNOHOMISHSNYDERSOCORROSOLANOSOMERSETSOMERVELLSONOMASOUTHAMPTONSOUTHEAST FAIRBANKSSPALDINGSPARTANBURGSPENCERSPINKSPOKANESPOTSYLVANIAST BERNARDST CHARLESST CLAIRST CROIXST FRANCISST FRANCOISST HELENAST JAMESST ИОАНН BAPTISTST JOHNSST JOSEPHST LANDRYST LAWRENCEST LOUISST ЛУИ CITYST LUCIEST MARTINST MARYST MARYSST TAMMANYSTAFFORDSTANISLAUSSTANLEYSTANLYSTANTONSTARKSTARKESTARRSTE GENEVIEVESTEARNSSTEELESTEPHENSSTEPHENSONSTERLINGSTEUBENSTEVENSSTEWARTSTILLWATERSTODDARDSTOKESSTONESTONEWALLSTORYSTRAFFORDSTUTSMANSUBLETTESUFFOLKSULLIVANSULLYSUMMERSSUMMITSUMNERSUMTERSUNFLOWERSURRYSUSQUEHANNASUSSEXSUTTERSUTTONSUWANNEESWAINSWEET GRASSSWEETWATERSWIFTSWISHERSWITZERLANDTALBOTTALLADEGATALLAHATCHIETALLAPOOSATAMATANEYTANGIPAHOATAOSTARRANTTATETATTNALLTAYLORTAZEWELLTEHAMATELLERTENSASTERREBONNETERRELLTERRYTETONTEXASTHAYERTHOMASTHROCKMORTONTHURSTONTIFTTILLAMOOKTILLMANTIOGATIPPAHTIPPECAN OETIPTONTISHOMINGOTITUSTODDTOLLANDTOM GREENTOMPKINSTOOELETOOLETOOMBSTORRANCETOWNERTRAILLTRANSYLVANIATRAVERSETRAVISTREASURETREGOTREMPEALEAUTREUTLENTRIGGTRINITYTRIPPTROUPTRUMBULLTUCKERTULARETULSATUNICATUOLUMNETURKS И CAICOSTURNERTUSCALOOSATUSCARAWASTUSCOLATWIGGSTWIN FALLSTYLERUINTAUINTAHULSTERUMATILLAUNIONUNORGANIZEDUPPER YUKONUPSHURUPSONUPTONUS MISC ТИХООКЕАНСКОГО ISUTAHUVALDEVAL VERDEVALDEZ-CHITNA-WHITIEVALDEZ-CORDOVAVALENCIAVALLEYVAN BURENVAN WERTVAN ZANDTVANCEVANDERBURGHVENANGOVENTURAVERMILIONVERMILLIONVERNONVICTORIAVIGOVILASVINTON-Виргинские острова Виргинские острова, BRITVIRGINIA BEACHVOLUSIAWABASHWABASHAWABAUNSEEWADENAWAGONERWAHKIAKUMWAKEWAKE ISLANDWAKULLAWALDOWALKERWALLA WALLAWALLACEWALLERWALLOWAWALSHWALTHALLWALTONWALWORTHWAPELLOWARDWAREWARRENWARRICKWASATCHWASCOWASECAWASHABAUGHWASHAKIEWASHBURNWASHINGTONWASHITAWASHOEWASHTENAWWATAUGAWATONWANWAUKESHAWAUPACAWAUSHARAWAYNEWEAKLEYWEBBWEBERWEBSTERWELDWELLSWEST ROUGEWEST CARROLLWEST BATON FELICIANAWESTCHESTERWESTMORELANDWESTONWETZELWEXFORDWHARTONWHAT COMWHEATLANDWHEELERWHITEWHITE PINEWHITESIDEWHITFIELDWHITLEYWHITMANWICHITAWICOMICOWILBARGERWILCOXWILKESWILKINWILKINSONWILLWILLACYWILLIAMSWILLIAMSBURGWILLIAMSONWILSONWINDHAMWINDSORWINKLERWINNWINNEBAGOWINNESHIEKWINONAWINSTONWIRTWISEWOODWOODBURYWOODFORDWOODRUFFWOODSWOODWARDWORCESTERWORTHWRANGELL-PETERSBURGWRIGHTWYANDOTWYANDOTTEWYOMINGWYTHEYADKINYAKIMAYAKUTATYALOBUSHAYAMHILLYANCEYYANKTONYATESYAVAPAIYAZOOYELLYELLOW MEDICINEYELLOWSTONEYOAKUMYOLOYORKYOUNGYUBAYUKON TERR, CANADAYUKON-KOYUKUKYUMAZAPATAZAVALAZIEBACH

Город: ВСЕ CITIESABBEVILLEABBOTSFORDABBOTTABERDEENABERDEEN полигонах (АБЕРДИН) АБЕРДИН / AMORYABERNATHYABILENEABINGDONABINGTONABITA SPRINGSABOITEABRAHAMS BAYABSARAKAACKERLYACKERMANACKLEYACMEACTONADAADA / ТВИН VALLEYADAIRADAK ISLANDADAMSADAMS MILLSADAMSBURGADDISONADDYADELADELANTOADINADJUNTASADRIANADVANCEAFTONAGANA GUAMAGATEAGAWAMAGUA CALIENTE SPRINGSAGUA DULCEAGUADILLAAGUILAAHOSKIEAHSAHKAAIBONITOAIKENAINSWORTHAITKINAJOAKELEYAKHIOKAKIACHAKAKIAKAKLAVIKAKRONAKRON SUFFIELDAKUTANALABASTERALACHUAALAKANUKALAMOALAMOGORDOALAMOSAALBAALBANYALBEMARLEALBERTALBERT LEAALBERTAALBERTONALBERTVILLEALBIAALBIONALBUQUERQUEALBURGALDERDALEALEDOALEKNAGIKALEXALEXANDERALEXANDER CITYALEXANDRIAALEXANDRIA BAYALFORDALGOAALGOMAALGONAALHAMBRAALICEALICEVILLEALKALI LAKEALLAKAKETALLAMUCHYALLEGANALLENALLENDALEALLENSPARKALLENTOWNALLIANCEALLIGATORALLIGERVILLEALLISONALLISON PARKALMAALMONDALMYRAALPENAALPINEALSIPALTA LOMAALTAMONTALTAMONTE SPRINGSALTHAALTOALTONALTON BAYALTON / ST LOUISALTOONAALTURASALTUSALVAALVARADOALVINALVORDALZADAAMA AMANAAMANDAAMARILLOAMBERAMBLERAMBOYAMELIAAMELIA СУД HOUSEAMENIAAMERICAN CREEKAMERICAN FALLSAMERICAN FORKAMERICUSAMERYAMESAMESBURYAMHERSTAMITEAMITYAMMONAMOAMOOK BAYAMORYAMOSAMSTERDAMANACONDAANACORTESANADARKOANAHEIMANAHIM LAKEANAHUACANAKTUVUK PASSANAMOOSEANAMOSAANATONEANCHOR BAYANCHOR POINTANCHORAGEANDALUSIAANDERSONANDICEANDOVERANDREASANDREWSANETAANGAUR ISLANDANGEL FIREANGELS CAMPANGIERANGLETONANGLETON / ОЗЕРО JACKSONANGOLAANGOONANGUSANGWINANIAKANIMASANITAANKENYANN ARBORANNAANNADAANNANDALEANNAPOLISANNETTEANNISTONANNONAANNVILLEANOKAANSELMOANSLEYANSONANSONIAANSTEDANTELOPEANTHONYANTIGOANTIOCHANTLERANTLERSANTON CHICOANVIKANZAAPACHE CREEKAPALACHICOLAAPEXAPOLLOAPOPKAAPPLE RIVERAPPLE SPRINGSAPPLE VALLEYAPPLETONAPPLINGAPPOMATTOXAQUINNAHARANSAS PASSARAPAHOEARBOVALEARBUCKLEARCADEARCADIAARCANUMARCATA / EUREKAARCHBOLDARCHERARCHER CITYARCHIEARCOARCOLAARCTIC VILLAGEARDMOREARECIBOARENAARENZVILLEARGONIAARGOSARGUSVILLEARGYLEARKADELPHIAARKANSAS CITYARKANSAWARKOEARLINGTONARLINGTON HEIGHTSARMAARMONKARMOURARMST RONGARNAUDVILLEARNO ATOLLAROCKARPARRIBAARRINGTONARTESIAARTHURARTHURDALEARTHURS TOWNARVILLAARVINASBURYASH FLATASHBURNASHBYASHCAMPASHDOWNASHEBOROASHEVILLEASHFORDASHFORD / WESTFORDASHLANDASHLAND / LINEVILLEASHLEYASHTABULAASHTONASHVILLEASOTINASPENASPERMONTASTORIAATCHISONATCOATHENSATHENS / ALBANYATHERTONATHOLATIKOKANATKAATKINSONATLANTAATLANTICATLANTIC BEACHATLANTIC CITYATLANTISATLINATMAUTLUAKATMOREATOKAATOMIC CITYATQASUKATTAPULGUSATTICAATTUATWATERATWOODAUBERRYAUBREYAUBURNAUBURN HILLSAUBURN / LEWISTONAUBURNDALEAUDUBONAUGUSTAAUMSVILLEAURORAAUSTELLAUSTINAVAAVALONAVANTAVENALAVENTURAAVILLAAVINGERAVOCAAVONAVON PARKAVONDALE ESTATESAYERAYERSVILLEAYLETTAYRAZLEAZTECAZUSABABBBABCOCKBABELTHUAP ISLANDBACKUSBAD AXEBADGERBAGDADBAGLEYBAGNELBAILEYBAILEYTONBAILEYVILLEBAINBRIDGEBAINBRIDGE ISLANDBAKERBAKER CITYBAKERSFIELDBAKEWELLBALCH CAMPBALD KNOBBALDWINBALDWIN CITYBALL GROUNDBALLINGERBALLSTONBALLYBALMORHEABALSAM LAKEBALTICBALTIMOREBAMBERGBANCROFTBANDERABANDONBANGORBANKSBANNER ELKBANNINGBANNISTERBANNOCKBAR HARBORBAR RIVERBARABOOBARANOFBARBOURVILLEBARDSTOWNBARDWELLBARGERSVILLEBARKSDALEBARLOWBARNESVILLEBARNEYBARNSTABLEBARNSTEADBARNSVILLEBARNWELLBARODABARREBARRE / BARRE PLAINSBARRE / MONTPELIERBARRIE-ORILLIABARRINGTONBARRONBARSTOWBARTER ISLANDBARTLESVILLEBARTLETTBARTLETT COVEBARTLEYBARTON CITYBARTONVILLEBARTOWBASEHORBASILEBASINBASIN CITYBASIN CREEKBASKINBASKING RIDGEBASSETTBASTROPBASYEBATAVIABATCHTOWNBATES CITYBATESBURGBATESVILLEBATHBATHGATEBATON ROUGEBATTLE CREEKBATTLE GROUNDBATTLE LAKEBATTLE MOUNTAINBAUDETTEBAXLEYBAXTER SPRINGSBAYBAY CITYBAY MINETTEBAY SHOREBAY SPRINGSBAY СТ LOUISBAY VIEWBAYAMONBAYFIELDBAYONNEBAYOU Л.А. BATREBAYPORTBAYTOWNBAYVIEWBAYVILLEBEACHBEACH CITYBEAN STATIONBEAR CREEKBEAR LAKEBEAR VALLEYBEARDSTOWNBEATRICEBEATTYBEAUFORTBEAUMONTBEAUMONT / ПОРТ ARTHURBEAVERBEAVER CREEKBEAVER DAMBEAVER FALLSBEAVER ISLANDBEAVER MARSHBEAVER SPRINGSBEAVERTONBECKLEYBECKWOURTHBEDFORDBEDMINSTERBEECHERBEEDEVILLEBEEKMANTOWNBEEVILLEBEGGSBEL AIRBELCHERBELCHERTOWNBELDENBELDINGBELENBELFASTBELFIELDBELFORDBELGRADEBELH AVENBELLBELL CITYBELL ISLANDBELL RANCHBELLA BELLABELLA COOLABELLAIREBELLEBELLE CHASSEBELLE FOURCHEBELLE GLADEBELLE ISLEBELLE MEADBELLE PLAINEBELLEFONTAINEBELLEFONTEBELLEVIEWBELLEVILLEBELLEVUEBELLFLOWERBELLINGHAMBELLSBELLVILLEBELLVUEBELLWOODBELMAR / FARMINGDALEBELMONDBELMONTBELOITBELPREBELTONBELUGABELVIDEREBELVIEWBELZONIBEMENTBEMIDJIBEN WHEELERBENDBENEDICTBENFERBENGEBENKELMANBENNETBENNETTBENNETTSVILLEBENNINGTONBENOITBENSALEMBENSONBENTLEYBENTONBENTON HARBORBENTONVILLEBERCLAIRBEREABERESFORDBERGERBERKELEY SPRINGSBERKLEYBERLINBERLIN CENTERBERNARDBERNARDS TOWNSHIPBERRIEN SPRINGSBERRYVILLEBERTHOLDBERTHOUDBERTHOUD FALLSBERTRAMBERWICKBERWYNBERYLBESSEMERBETHANYBETHANY CENTERBETHELBETHESDABETHLEHEMBETHPAGEBETHUNEBETTLESBEULAHBEVENTBEVERLYBIDDEFORDBIEBERBIG Амбергрис CAYBIG МЕДВЕДЬ МЕДВЕДЬ CITYBIG LAKEBIG CREEKBIG ЗАВОДЬ РЕНДЖЕР STATIONBIG FALLSBIG LAKEBIG MOUNTAINBIG PINEYBIG RAPIDSBIG ROCKBIG SANDYBIG SKYBIG SPRINGBIG КАМЕННЫЙ GAPBIG TIMBERBIG WATERBIGELOWBIGFOOTBIGFORKBIGGSBIGGSVILLEBIGLERVILLEBILLBILLINGSB ILOXIBINGHAMBINGHAM LAKEBINGHAMTONBIRCH CREEKBIRCH RUNBIRCHWOODBIRD CITYBIRDSBOROBIRMINGHAMBISBEEBISHOPBISHOPVILLEBISMARCKBISMARKBISONBIVINSBIXBYBLACK CREEKBLACK DIAMONDBLACK EARTHBLACK HAWKBLACK OAKBLACK RAPIDSBLACK РЕКА FALLSBLACKFOOTBLACKHAWKBLACKJACKBLACKSBURGBLACKSTONEBLACKWELLBLADENBOROBLAINEBLAIRBLAIRSTOWNBLAIRSVILLEBLAKELYBLAKELY ISLANDBLAKESBURGBLAKESLEEBLANCABLANCHARDBLANCHESTERBLANCOBLANDINGBLAWNOXBLISSBLISSFIELDBLOCK ISLANDBLOOMERBLOOMFIELDBLOOMING GROVEBLOOMINGBURGBLOOMINGTONBLOOMINGTON / NORMALBLOOMSBURGBLOUNTSTOWNBLOUNTSVILLEBLOXOMBLUE ASHBLUE EARTHBLUE EYEBLUE HILLBLUE MOUNDBLUE ГОРА LAKEBLUE RIDGEBLUE SPRINGSBLUEBELLBLUEFIELDBLUEMONTBLUFFBLUFFTONBLUMBLYBLYTHEBLYTHEVILLEBOARDMANBOAZBOCA GRANDEBOCA RATONBODINESBOERNEBOGALUSABOGATABOGGSTOWNBOIS БЛАН ISLANDBOISEBOISE CITYBOKCHITOBOLCKOWBOLINGBROOKBOLIVARBOLTONBOLTON LANDINGBONANZABONESTEELBONFIELDBONHAMBONIFAYBONNE TERREBONNEAUBONNER SPRINGSBONNERS FERRYBOOKERBOONEBOONES CROSSROADSBOONEVILLEBOONEVILLE / BALDWYNBOONVILLEB OOTHBAYBOOTHVILLEBORDENBORDENTOWNBORGERBORINGBORONBORREGO SPRINGSBOSCOBELBOSQUEBOSSIER CITYBOSTONBOSTWICKBOSWELLBOSWELL BAYBOTTINEAUBOTTLE Крик и WHITBYBOULDERBOULDER CITYBOULDER JUNCTIONBOUND BROOKBOUNDARYBOUNDARY BAYBOUNTIFULBOURBONBOURNEBOUSEBOVINABOWBOWBELLSBOWDLEBOWDOINHAMBOWDONBOWIEBOWLING GREENBOWMANBOWSTRINGBOX ELDERBOXBOROUGHBOXELDER / LYDIABOYCEBOYCEVILLEBOYDBOYDSBOYDTONBOYKINBOYKINSBOYNE CITYBOYNE FALLSBOYNTON BEACHBOZEMANBOZRAHBRACEWELLBRACKETTVILLEBRACKETVILLEBRADDOCKBRADENTONBRADFORDBRADYBRAGGSBRAINARDBRAINERDBRAITHWAITEBRANCHVILLEBRANDONBRANDONVILLEBRANDYWINEBRANFORDBRANSONBRANSON WESTBRATTLEBOROBRAWLEYBRAYBRAZILBRAZORIABREAUX BRIDGEBRECKENRIDGEBRECKSVILLEBREESEBREEZEWOODBREEZY POINTBREINIGSVILLEBREMENBREMERTONBRENHAMBRENTWOODBREVARDBREVIG MISSIONBREWERBREWSTERBREWTONBRICKBRICK ЦЕРКОВЬ VILLAGEBRICKEYSBRIDGEPORTBRIDGERBRIDGETONBRIDGEVILLEBRIDGEWATERBRIDGMANBRIDGTONBRIDPORTBRIGGSBRIGGSDALEBRIGGSVILLEBRIGHAM CITYBRIGHTONBRIMFIELDBRINKLEYBRINNONBRISTOLBRISTOL / ДЖОНСОН / KINGSPO RTBRISTOLVILLEBRISTOWBRITTONBROADALBINBROADUSBROADVIEW HEIGHTSBROADWATERBROADWAYBROADWAY HEIGHTSBROCKBROCKPORTBROCKTONBROCTONBRODHEADBROGUEBROKEN BOWBROOKFIELDBROOKHAVENBROOKINGSBROOKLANDVILLEBROOKLINEBROOKLYNBROOKNEALBROOKSBROOKSHIREBROOKSVILLEBROOKVILLEBROOTENBROUSSARDBROWN DEERBROWNFIELDBROWNINGBROWNLEEBROWNLEE VILLAGEBROWNSBROWNS MILLSBROWNSBOROBROWNSBURGBROWNSVILLEBROWNVILLEBROWNWOODBRUCEBRULEBRUNDAGEBRUNEAUBRUNIBRUNSWICKBRUSHBRUSH PRAIRIEBRUSSELSBRYANBRYCE CANYONBRYN ATHYNBRYONBRYSON CITYBRYTEBUCHANANBUCHANAN DAMBUCK CREEKBUCKEYEBUCKHANNONBUCKHEADBUCKHOLTSBUCKINGHAMBUCKINHAMBUCKLANDBUCKLEYBUCKLINBUCKMANBUCYRUSBUDABUENABUENA VISTABUFFALOBUFFALO CENTERBUFFALO SPRINGSBUFORDBUHLBULGERBULL VALLEYBULLARDBULLHEAD CITYBULLOCKS HARBOURBULVERDEBUMPASSBUNKER HILLBUNKIEBUNNBUNNELLBURASBURBANKBURDETTBURGAWBURGESSBURKBURNETTBURKEBURKESVILLEBURLESONBURLEYBURLINGTONBURLINGTON COUNTYBURLINGTON JUNCTIONBURLINGTON / MOUNT VERNONBURLISONBURNABURNETBURNETTSVILLEBURNEYBURNEYVILLEBURNHAMBURNIPSBURNSBURNS FLATBURNS LAKEBURNSIDEBURNSVILLEBURNT CABINSBURNT CHIMNEYBURRBURRTONBURTONBURWASHBURWELLBUSCHBUSHBUSHKILL TOWNSHIPBUSHNELLBUTLERBUTLERVILLEBUTTEBUTTONWILLOWBUXTONBYERSBYHALIABYNUMBYRNEVILLEBYRONCABLECABO ROJOCABOOLCABOTCADDOCADDO MILLSCADECADILLACCADIZCADOTTCAHOKIA / ST LOUISCAIROCAL NEV ARICALABASASCALAISCALDWELLCALEDONIACALERACALEXICOCALHANCALHOUNCALHOUN CITYCALICO ROCKCALIENTECALIFORNIACALIFORNIA CITYCALIPATRIACALLAGHANCALLAOCALLAWAYCALLERYCALLIHAMCALPINECALUMETCALVERT CITYCALVERTONCALVINCAMARILLOCAMASCAMBELLTONCAMBRIACAMBRIDGECAMBRIDGE SPRINGSCAMDENCAMDENTONCAMERONCAMERON PARKCAMILLACAMILLUSCAMP Blanding MIL РЭС (STARKE) CAMP CROOKCAMP Доусон (KINGWOOD) CAMP DOUGLASCAMP JUSTICECAMP LAKECAMP MACKALLCAMP POHAKULOACAMP RIPLEYCAMP ROBERTSCAMP РОБЕРТС / САН MIGUELCAMP РОБИНСОН / МЕНЬШИЙ ROCKCAMP Сан-Луис OBISPOCAMP SHELBYCAMP SPRINGSCAMP VERDECAMP WOODCAMPBELLCAMPBELL RIVERCAMPBELLSVILLECAMPBELLTONCAMPUSCANAANCANADENSISCANADIANCANADICECANAJOHARIECANAL FULTONCANANDAIGUACANASTOTACANBYCANDELARIACAN DIACANDLECANDLERCANDOCANDORCANEYCANFIELDCANKTONCANNON FALLSCANOGA PARKCANONCANON CITYCANONSBURGCANTONCANTWELLCANYON LAKECAPAYCAPE CARTERETCAPE CHARLESCAPE CORALCAPE DECISIONCAPE GIRARDEAUCAPE LISBURNECAPE МАЯ СУД HOUSECAPE NEWENHAMCAPE POLECAPE ROMANZOFCAPE SARICHEFCAPE SPENCERCAPE VINCENTCAPITANCAPON BRIDGECAPRONCARBONDALECARBONDALE / MURPHYSBOROCARDINGTONCARDWELLCAREFREECARENCROCAREYCARIBOUCARL JUNCTIONCARLETONCARLINVILLECARLISLECARLSBADCARLTONCARMACKSCARMELCARMICARMICHAELCARMICHAELSCARMICHEALCARNEGIECARNESVILLECAROCAROLEENCAROLINA BEACHCARPINTERIACARRCARRABASSETTCARRABELLECARRIERCARRIERECARRINGTONCARRIZO SPRINGSCARRIZOZOCARROLLCARROLLTONCARSONCARSON CITYCARSONVILLECARTA VALLEYCARTERSVILLECARTHAGECARUTHERSCARUTHERSVILLECARVERCARVILLECARYCARYVILLECASA GRANDECASCADECASCADE LOCKSCASEYCASHCASHIERSCASHIONCASHMERECASPERCASSADAGACASSELTONCASSOPOLISCASSVILLECASTAICCASTALIACASTLE HAYNECASTLE ROCKCASTLETONCASTRO VALLEYCASTROVILLECATARINACATAWBACATHEDRAL CITYCATHLAMETCATLETTCATOOSACATTARAUGUSCA VALIERCAVANAUGH BAYCAVE JUNCTIONCAVE SPRINGCAVE SPRINGSCAVENDISHCAVOURCAYUSE CREEKCECILCECILTONCEDARCEDAR BLUFFCEDAR CITYCEDAR FALLSCEDAR FORTCEDAR GROVECEDAR ISLANDCEDAR KEYCEDAR LAKECEDAR PARKCEDAR RAPIDSCEDAR SPRINGSCEDARBURGCEDARCREEKCEDAREDGECEDARTOWNCEDARVILLECEIBACELEBRATIONCELINACENTERCENTER ISLANDCENTER OSSIPEECENTER POINTCENTERBURGCENTERTONCENTERTOWNCENTERVIEWCENTERVILLECENTRALCENTRAL CITYCENTRAL POINTCENTRAL SQUARECENTRALHATCHEECENTRALIACENTRECENTRE HALLCENTRE ISLANDCENTREVILLECENTURYCERESCERRO GORDOCEYLONCHADRONCHAFFEECHAGRIN FALLSCHALKYITSIKCHALLISCHALMETTECHAMACHAMBERLAINCHAMBERLAIN СТРАЖНИК STATIONCHAMBERS ISLANDCHAMBERSBURGCHAMBERSVILLECHAMPAIGNCHAMPAIGN / URBANACHAMPIONCHANDALAR CAMPCHANDALAR LAKECHANDLERCHANHASSEN VILLAGECHANNAHONCHANNELVIEWCHANUTECHAPEL HILLCHAPINCHAPMANCHAPMANSBOROCHAPPELLCHAPPELL HILLCHARDONCHARENTONCHARITONCHARLES CITYCHARLESTONCHARLESTOWNCHARLEVOIXCHARLOTTECHARLOTTE AMALIECHARLOTTE Amalie ST THOMASCHARLOTTESVILLECHARLTONCHASE CITYCHASKACHATAIGNIERCHAT FIELDCHATHAMCHATHAM TOWNSHIPCHATOMCHATSWORTHCHATTAHOOCHEECHATTANOOGACHAUVINCHAVIESCHEBANSECHEBEAGUE ISLANDCHEBOYGANCHEFORNAKCHEHALISCHELANCHELSEACHEMEHUEVI VALLEYCHENA ГОРЯЧИЙ SPRINGSCHENEGACHENEYCHENOACHERAWCHERITONCHEROKEECHERRY HILLCHERRY POINTCHERRY VALLEYCHERRYVILLECHESANINGCHESAPEAKECHESAPEAKE CITYCHESAPEAKE / Хантингтон WVACHESNEECHESTERCHESTERFIELDCHESTERTONCHESTERTOWNCHESUNCOOKCHETEKCHEVAKCHEVERLYCHEWELAHCHEYENNECHEYENNE WELLSCHICAGOCHICAGO / AURORACHICAGO / озеро в HILLSCHICAGO / Oak Lawn / Чикаго / Prospect Heights / WHEELINGCHICAGO / ROCKFORDCHICAGO / ROMEOVILLECHICAGO / SCHAUMBURGCHICAGO / Tinley PARKCHICAGO / WAUKEGANCHICAGO / ЗАПАД CHICAGOCHICKALACHICKALOONCHICKAMAUGACHICKASHACHICKENCHICOCHICOPEECHICORACHIEFLANDCHIGNIKCHIGNIK LAGOONCHIGNIK LAKECHILCOOTCHILDERSBURGCHILDRESSCHILESCHILHOWIECHILLICOTHECHILOQUINCHILTONCHINACHINA GROVECHINA LAKECHINA SPRINGCHINLECHINOCHINO VALLEYCHINOOKCHIPLEYCHIPPEWA FALLSCHIRIACO SUMMITCHISANACHISHOLMCHISHOLM / HIBBINGCHISTOCHINACHITINACHITTENANGOCHLORIDECHOTEAUCHOUTEA UCHOWCHILLACHRISTIANSBURGCHRISTIANSTEDCHRISTIANSTED ST CROIXCHRISTMAS VALLEYCHUATHBALUKCHUCKEYCHUGIAKCHUGWATERCHULA VISTACHULUOTACHURCH HILLCHURCH POINTCHURCHVILLECHURUBUSCOCIBECUECICEROCIMARRONCINCINNATICINNAMINSONCIRCLECIRCLE ГОРЯЧИЙ SPRINGSCIRCLEVILLECISCOCITRACITRONELLECITY ИЗ COMMERCECITY OF INDUSTRYCLACKAMASCLAIRETTECLAM GULCHCLAM LAKECLANTONCLARA CITYCLARECLAREMONTCLAREMORECLARENCE CENTERCLARENDONCLARINDACLARIONCLARISSACLARKCLARK FORKCLARKESVILLECLARKIACLARKS POINTCLARKSBOROCLARKSBURGCLARKSDALECLARKSONCLARKSTONCLARKSVILLECLARKTONCLAUDECLAUNCHCLAXTONCLAYCLAY CENTERCLAY CITYCLAYSVILLECLAYTONCLAYTON LAKECLE ELUMCLEARCLEAR LAKECLEARFIELDCLEARLAKECLEARWATERCLEBURNECLEMENTSCLEMENTSVILLECLEMMONSCLEMSONCLEO SPRINGSCLERMONTCLEVELANDCLEWISTONCLIFFORDCLIFTONCLIFTON FORGECLIFTON / MORENCICLIMAX SPRINGSCLINTCLINTONCLINTON TOWNSHIPCLINTONVILLECLINTWOODCLIOCLOQUETCLOVERCLOVERDALECLOVISCLUTECLYDECLYMERCLYOCOAL GATECOALDALECOALGATECOALINGACOALTONCOALVILLECOATESCOATESVILLECOATSVILLECOBB ISLANDCOBURGCOC HRANCOCHRANTONCOCHRANVILLECOCKBURN HARBOURCOCKBURN TOWNCOCOACOCOA BEACHCOCODRIECODYCOEBURNCOEUR D’ALENECOFFEYVILLECOFFMAN COVECOGSWELL / BRAMPTON / COHAGENCOHASSETCOITSVILLECOKEVILLECOLBERTCOLBYCOLCHESTERCOLD BAYCOLD ЛУГОВ СТРАЖНИК STATIONCOLDENCOLDFOOTCOLDWATERCOLEBROOKCOLEMANCOLES POINTCOLFAXCOLLEGE PARKCOLLEGE PLACECOLLEGE POINTCOLLEGE STATIONCOLLEGEDALECOLLEGEVILLECOLLIERVILLECOLLINSCOLLINSVILLECOLOGNECOLOMECOLONACOLONEL HILLCOLONIAL HEIGHTSCOLORADO CITYCOLORADO CREEKCOLORADO SPRINGSCOLSTRIPCOLTCOLTONCOLTS NECKCOLUMBIACOLUMBIA CITYCOLUMBIA FALLSCOLUMBIA FURNACECOLUMBIA STATIONCOLUMBIA / КРЕПЛЕНИЯ PLEASANTCOLUMBIANACOLUMBUSCOLUMBUS GROVECOLUMBUS / W POINT / STARKVILLECOLUMIA Перекрестная ROADSCOLUSACOLVILLECOMANCHECOMETACOMFORTCOMMERCECOMOXCOMPTONCOMSTOCKCONCHAS DAMCONCORDCONCORDIACONCRETECONDONCONESVILLECONEVILLECONGO TOWNCONNELLCONNELLSVILLECONNERCONNERSVILLECONOWINGOCONRADCONROECONSHOHOCKENCONSTANTIACONVENTCONVERSECONWAYCONWAY SPRINGSCONYERSCOOKCOOKEVILLECOOKSONCOOKSVILLECOOLIDGECOOLINCOON RAPIDSCOOPE RCOOPER LANDINGCOOPERSBURGCOOPERSTOWNCOOPERTONCOOS BAYCOPAKECOPALISCOPLAYCOPPER CENTERCOPPERHILLCOQUILLECORBETTCORBINCORCORANCORDELECORDELLCORDOVACORINNECORINTHCORNELIACORNELIUSCORNELLCORNINGCORNUCOPIACORNWALLCOROLLACORONACORONADOCORPUS CHRISTICORRIGANCORRYCORSICACORSICANACORTEZCORTLANDCORUNNACORVALLISCORWITHCORYDONCOSHOCTONCOSMOSCOSTA MESACOTOPAXICOTTAGE GROVECOTTERCOTTONTONCOTTONWOODCOTTONWOOD FALLSCOTUITCOTULLACOUDERSPORTCOUGARCOULEE CITYCOULTERVILLECOUNCECOUNCILCOUNCIL BLUFFSCOUNCIL GROVECOUPEVILLECOUPLANDCOURTENAYCOURTLANDCOUSHATTACOVECOVE NECKCOVELOCOVENTRYCOVENTRYVILLECOVINGTONCOWETACOWLEY / Ловелл / BYRONCOXSACKIECOYCOYOTE SPRINGSCOZADCRAB ORCHARDCRAIGCRAIGMONTCRAIGSVILLECRANBERRYCRANBERRY ISLESCRANBURYCRANDALLCRANDONCRANECRANE LAKECRANFILLS GAPCRAWFORDCRAWFORDSVILLECREEDECREEDMOORCREIGHTONCREOLACREOLECRESCENTCRESCENT CITYCRESCENT LAKECRESCENT VALLEYCRESCOCRESENT CITYCRESSONCRESTED BUTTECRESTLINECRESTONCRESTVIEWCRESTWOODCRESWELLCRETECREVICE CREEKCREWECRISFIELDCRITZCRIVITZCROCKERCRO CKETTCROOKED CREEKCROOKSTONCROSBYCROSBYTONCROSSCROSS ANCHORCROSS CITYCROSS CREEKCROSS JUNCTIONCROSS KEYSCROSS PLAINSCROSS ROADSCROSSETTCROSSROADSCROSSVILLECROSSWIND LAKECROSWELLCROWELLCROWLEYCROWNCROWN KINGCROWN POINTCROWNPOINTCROWS LANDINGCROYDONCROZETCRYSTAL BEACHCRYSTAL CITYCRYSTAL FALLSCRYSTAL RIVERCRYSTAL SPRINGSCUB Лейк-Кристал RUNCUBACUBEROCUEROCULBERTSONCULEBRACULLENCULLEOKACULLMANCULMERVILLECULPEPERCULVERCUMBERLANDCUMBERLAND ISLANDCUMBYCUMMINGCUNNINGHAMCURRANTCURRITUCKCURTISCURWENSVILLECUSHINGCUSTERCUSTER PARKCUT BANKCUTHBERTCUTLERCUTTYHUNKCUYAHOGA FALLSCUYAMACYNTHIANACYPRESSDACONODADE CITYDADEVILLEDAGGETTDAHL CREEKDAHLGRENDAHLONEGADAINGERFIELDDAKOTA CITYDALEYVILLEDALHARTDALLASDALLAS CENTERDALLAS-ФОРТ WORTHDALMATIADALTONDAMERONDAMONDANBURYDANBYDANDRIDGEDANEDANEVANGDANFORTHDANIELDANIELSONDANSVILLEDANVILLEDANVILLLEDAPHNEDARBYDARBYVILLEDARDANELLEDARIENDARLINGTONDARMSTADTDARNELLDARRINGTONDARROUZETTDATELANDDAUPHIN ISLANDDAVENPORTDAVEYDAVID CITYDAVIEDAVILLADAVISDAVIS / WOODLAND / ЗИМы DAVISONDAWSONDAWSON CITYDAWSON SPRINGSDAWSONVILLEDAYDAYS CREEKDAYTONDAYTON / КАРСОН CITYDAYTONA BEACHDAYVILLEDAZEYDE FORESTDE FUNIAK SPRINGSDE KALBDE LANDDE LEONDE ЛЕОН SPRINGSDE PEREDE QUEENDE QUINCYDE RIDDERDE SMETDE SOTODE WITTDEADHORSEDEADMANS CAYDEALEDEARBORNDEASE LAKEDEATH желобок JUNCTIONDEATH Valley National PARKDEATSVILLEDEBLOISDECATURDECATUR ISLANDDECKERDECORAHDEEPWATERDEER GROVEDEER LODGEDEER PARKDEER RIVERDEER TRAILDEERFIELDDEERINGDEERWOODDEETHDEFIANCEDEFUNIAK SPRINGSDEGRASSEDEL NORTEDEL REYDEL RIODEL VALLEDELANDDELANODELANSONDELAVANDELAWAREDELCAMBREDELEVANDELHIDELLDELL CITYDELL RAPIDSDELMARDELMONTDELPHIDELPHOSDELRAY BEACHDELTADELTA JUNCTIONDELTA СОЕДИНЕНИЯ FT GREELYDELTONADEMINGDEMOPOLISDEMOTTEDENHAM SPRINGSDENIODENISONDENMARKDENNISONDENTONDENVERDENVER CITYDERBYDERMOTTDERRYDES ARCDES MOINESDES PLAINESDESERT CENTERDESERT HOT SPRINGS DICKINSONDICKSONDIGHTONDILLEYDILLINGHAMDILLONDILLON / SILVERTHORNEDILLWYNDIMMITTDINSMOREDIOMEDEDISCOVERY BAY / MAYNARDDISNEYDIXFIELDDIXIEDIXONDODGE CENTERDODGE CITYDODGEVILLEDOLAN SPRINGSDOLANDDONALDDONALDSONVILLEDONALSONVILLEDONGOLADONIPHANDONNELLSVILLEDONNELLYDONOVANDORCHESTERDORRDORRANCEDORRISDORSETDORSEYVILLEDOS PALOSDOTHANDOUBLE SPRINGSDOUGLASDOUGLAS BISBEEDOUGLASSDOUGLASVILLEDOUSMANDOVE CREEKDOVERDOVER FOXCROFTDOVER / CHESWOLDDOVER / FOXCROFTDOVER-FOXCROFTDOWDOWAGIACDOWELLTOWNDOWNERS GROVEDOWNEYDOWNINGTOWNDOWNSDOYLESTOWNDRAPERDRAYDENDRAYTONDRESDENDRESSERDREWDREXELDRIGGSDRIPPING SPRINGSDRUMMONDDRUMMOND ISLANDDRY CREEKDRY RIDGEDRYDENDRYTOWNDU QUOINDUANESBURGDUBLINDUBOISDUBUQUEDUCHESNEDUCK КРИК VILLAGEDUCKWATERDUDLEYDUFFIELDDUGWAY доказав GROUNDDULCEDULL CENTER / SW CLARETON / DULUTHDUMASDUMMERDUNBARTONDUNCANDUNCANNONDUNCANSVILLEDUNDEEDUNEDINDUNKIRKDUNLAPDUNNDUNN CENTERDUNNELLONDUNNINGDUNSEITHDUNSMUIRDURANDDURANGODURANTDURHAMDURHAMVILLEDUSHOREDUSONDUTCH HARBORDUTCH JOHNDUTTONDWIGHTDYERDYERSBUR GDYERSVILLEEADSEAGLEEAGLE BUTTEEAGLE GROVEEAGLE HARBOREAGLE LAKEEAGLE MOUNTAINEAGLE PASSEAGLE POINTEAGLE RIVEREAGLE ROCKEAGLES MEREEAGLEVILLEEAKLYEARL PARKEARLEEARLVILLEEASLEYEAST BANGOREAST BERLINEAST BRADYEAST CANTONEAST DUBLINEAST FALMOUTHEAST FREETOWNEAST GRANBYEAST GRAND FORKSEAST GULL LAKEEAST HADDAMEAST HAMPTONEAST HARTFORDEAST HELENAEAST HOMEREAST JORDANEAST KILLINGLYEAST LIBERTYEAST LIVERPOOLEAST ЛИВЕРПУЛ — CHESTEREAST LYNNEEAST MOLINEEAST MORICHESEAST ORANGEEAST PALESTINEEAST PALMYRAEAST POINTEAST PRAIRIEEAST PROSPECTEAST RAYMONDEAST RUTHERFORDEAST SCHODACKEAST SOUNDEAST STROUDSBURGEAST SUMNEREAST TAWASEAST TROYEAST WENATCHEEEAST WINDSOREAST ВИНДЗОР HILLEAST WINTHROPEASTFORDEASTLANDEASTMANEASTONEASTON-ВИЛЫ TOWNSHIPEASTOVEREASTPORTEASTSOUNDEATONEATON RAPIDSEATONTONEATONVILLEEAU CLAIREEBENSBURGEBROECAILLEECHOECKERT / CITYECKLEYECTOREDCOUCHEDDYEDDYVILLEEDENEDENTONEDGARTOWNEDGELEYEDGEMONTEDGERTONEDGEWATEREDGEWOODEDGEWOOD ARSENALEDINAEDINBURGEDISONEDMONDEDMONDSEDNAEDNA САД ЛВЖ LEDWARDSEDWARDSVILLEEEKEFFINGHAMEFLANDEGEGIKEGNAREHRHARDTEIGHTY FOUREKALAKAEKUKEKWOKEL CAMPOEL CENTROEL DORADOEL ДОРАДО SPRINGSEL MIRAGEEL MONTEEL PASOEL RENOEL SEGUNDOELAINEELANDELBAELBERTELBERTAELBERTONELBOW LAKEELBRIDGEELDERSBURGELDONELDORAELDORADOELDRED ROCKELDRIDGEELECTRIC CITYELEPHANT FORKELEVAELFIN COVEELGINELIMELIOTELIZABETHELIZABETH CITYELIZABETHTONELIZABETHTOWNELIZABETHVILLEELIZABETHVILLE / HALIFAXELKELK CITYELK CREEKELK GROVEELK РОЩА VILLAGEELK MOUNDELK POINTELK RAPIDSELK RIVERELKADERELKDALEELKHARTELKHORNELKINELKINSELKLANDELKOELKTONELLAMARELLENDALEELLENSBURGELLENTONELLENVILLEELLICOTTELLIJAYELLINGTONELLINWOODELLIOTTELLISON BAYELLISTONELLSWORTHELLWOOD CITYELMAELMDALEELMENDORFELMERELMHURSTELMIRAELMIRA / CORNINGELMOELMONTELMOREELMORE CITYELMWOODELONELON COLLEGEELOYELROYELSBERRYELTONELWELLELWOODELYELY / PIOCHEELYRIAELYSBURGELYSIANEMERALDEMIGRANT GAPEMINENCEEMMETSBURGEMMETTEMMITSBURGEMMITTSBURGEMMONAKEMORYEMPIREEMPORIAEMPORIUMENCAMPMENTENCINALENCINITASENCINOENDERLINENDICOTTENEWETAKENFI ELDENGELHARDENGLANDENGLEWOODENGLISHENGLISHTOWNENIDENNINGENNISENON VALLEYENOSBURG FALLSENSENADAENTERPRISEENUMCLAWEOLIAEPHRAIMEPHRATAEPHRATAHERAERICKERICSONERIEERINERLANGERERROLERSKINEERWINERWINNAERWINVILLEESCALANTEESCANABAESCONDIDOESKRIDGEESMONDESPANOLAESPARTOESPERANCEESSEXESSEX JUNCTIONESSINGTONESTACADAESTANCIAESTELLINEESTEROESTERWOODESTES PARKESTHERVILLEESTILLESTILL SPRINGSETHRIDGEETNAETONEUCLIDEUDORAEUFAULAEUGENEEUHARLEEEUNICEEUPORAEUREKAEUREKA CREEKEUREKA SPRINGSEUSTACEEUSTISEUTAWEVA CREEKEVADALEEVANSEVANSTONEVANSVILLEEVARTEVELETHEVERETTEVERGLADESEVERGLADES CITYEVERGREENEVERMANEVERSONEVERTONEVESHAMEXCELSIOREXCELSIOR SPRINGSEXCURSION INLETEXELANDEXETEREXPORTEXTONEYOTAFABENSFABIUSFACTORYVILLEFAIR BLUFFFAIR GROVEFAIR HAVENFAIRBANKSFAIRBANKS / FT WAINWRIGHT / FAIRBANKS / FT WAINWRIGHTFAIRBORNFAIRBURNFAIRBURYFAIRDEALINGFAIRFAXFAIRFIELDFAIRHOPEFAIRLANDFAIRLESS HILLSFAIRMONTFAIRMOUNTFAIRPLAINFAIRPLAYFAIRTONFAIRVIEWFAITHFAJARDOFALCONFALFURRIASFALL BRANCHFALL CITYFALL RIVERFALL RIVER MILLSFALLBRO OKFALLONFALLS CITYFALLS-OF-ROUGHFALLSTONFALMOUTHFALSE ISLANDFALSE PASSFAMOSOFANNETTFAR ROCKAWAYFAREWELLFAREWELL LAKEFARGOFARIBAULTFARMER CITYFARMERS RETREATFARMERSBURGFARMERSVILLEFARMERVILLEFARMINGDALEFARMINGTONFARMINGTON HILLSFARMVILLEFARRAGUTFARRARFARRELLFARWELLFATEFAUCETTFAULKTONFAYETTEFAYETTEVILLEFAYETTEVILLE / SPRINGDALE / ROGERSFEATHER RIVERFEATHERVILLEFEATHERVLLEFEDERALSBURGFELICITYFELLSMEREFELTONFENCE LAKEFENNIMOREFENNVILLEFENTRESSFERDINANDFERGUS FALLSFERGUSONFERNANDINA BEACHFERNDALEFERNEYFERNLEYFERRIDAYFERRIS / КРАСНЫЙ OAKFERRYVILLEFERTILEFESSENDENFESTUSFIDDLETOWNFIELDSFIFE LAKEFILERFILLMOREFINCASTLEFINCHVILLEFINDLAYFINKSBURGFINLEYVILLEFINLYFIREBAUGHFIRESTONEFIRTHFISCHERFISH LAKEFISHERFISHERS ISLANDFISHERSVILLEFISKFITCHBURGFITHIANFITIUTA VILLAGEFITZGERALDFIVE FINGERFIVE POINTSFLAGLERFLAGSTAFFFLANDREAUFLATFLAT ROCKFLATONIAFLEETVILLEFLEMINGSBURGFLEMINGTONFLETCHERFLICKSVILLEFLINTFLINTONFLIPPINFLOMATONFLORAFLORALAFLORENCEFLORESVILLEFLORHAM PARKFLORIDA CITYFLORISSANTFLOWER MOUNDFLOWERY Branc HFLOWOODFLOYDFLOYDADAFLUSHINGFOLEYFOLKSTONFOLLETTFOLSOMFOND DU LACFONTANAFORDFORDSFORDVILLEFORDYCEFORESTFOREST CITYFOREST GLENFOREST GROVEFOREST HILLFOREST LAKEFOREST PARKFOREST TOWNSHIPFORESTBURGFORESTVILLEFORGANFORISTELLFORKED RIVERFORKLANDFORKSFORNEYFORRESTFORREST CITYFORSYTHFORT А.П. городищем ANNFORT ATKINSONFORT BELVOIRFORT БЕНДЖАМИН HARRISONFORT BENNING (COLUMBUS) ФОРТ BENTONFORT BIDWELLFORT BLISS / EL PASO / FORT BRAGGFORT BRIDGERFORT CALHOUNFORT КЕМПБЕЛЛ (CLARKSVILLE) FORT CAMPBELL / HOPKINSVILLEFORT CARSONFORT CHAFFEEFORT COLLINSFORT КОЛЛИНС / LOVELANDFORT DENAUDFORT DEPOSITFORT Детрике (Frederick) ФОРТ DODGEFORT DRUMFORT EDWARDFORT EUSTISFORT FAIRFIELDFORT GAINESFORT GARLANDFORT ГОРДОН (АУГУСТА) ФОРТ городище КЛОБУК (KILLEEN) Форт Худ / KILLEENFORT КЛОБУК / KILLEEN / ФОРТ Huachuca СЬЕРРА VISTAFORT ОХОТНИК LIGGET JOLONFORT Indiantown GAP (Annville) ФОРТ IRWIN / BARSTOWFORT JACKSONFORT JENNINGSFORT JOHNSONFORT JONESFORT KENTFORT KNOXFORT LAUDERDALEFORT LEAVENWORTHFORT LEEFORT ЛЕОНАРД WOODFORT LEWISFORT ЛЬЮИС / TACOMAFORT MADISONFORT MC COYFORT MCKAVETTFORT MCPHERSONFORT MEADEFORT MEADE (ODENTON) RUCOMAFORT MADISONFORT MORGANFORT MYERSFORT PAYNEFORT PECKFORT PIERCEFORT PLAINFORT PAYNEFORT PECKFORT PIERCEFORT PLAINFORT POLKFORT RICHORIUCON (ANFERSONFORT MEADEFORT MEADE) / ELBAFORT RUCKER / GOODMANFORT RUCKER / HARTFORDFORT RUCKER / Kirklands CROSSROADSFORT RUCKER / LOUISVILLEFORT RUCKER / НОВЫЙ BROCKTONFORT RUCKER / NEWTONFORT RUCKER / OPPFORT RUCKER / OZARKFORT RUCKER / SAMSONFORT RUCKER / WICKSBURGFORT SCOTTFORT SILLFORT SMITHFORT СТЮАРТ (Хайнсвилль) ФОРТ STOCKTONFORT SUMNERFORT THOMASFORT VALLEYFORT WAINWRITEFORT УОЛТОН BEACHFORT WASHINGTONFORT WAYNEFORT WHITEFORT WORTHFORT YATESFORT YUKONFORTINEFORTUNAFORTVILLEFOSSTONFOSTORIAFOUNTAINFOUNTAIN HILLFOUNTAIN RUNFOUNTAIN VALLEYFOWLERFOWLERTONFOWLERVILLEFOX LAKEFOXBOROUGHFOXBURGFOXWORTHFRAMINGHAMFRANCESVILLEFRANCONIAFRANKENMUTHFRANKFORDFRANKFORTFRANKLINFRANKLIN GROVEFRANKLIN TOWNSHIPFRANKLIN / GLENNFRANKLINTONFRANKSTONFRANKSVILLEFRANKTONFRANKTOWNFRASERFRAZERFRAZIER PARKFREDERICKFREDERICKSBURGFREDERICKTOWNFREDERIKSTED ST CROIXFREDONIAFREDRICKSBURGFREEDOMFREEHOLDFREEHOLD TOWNSHIPFREEMANFREEPORTFREERFREETOWNFREMONTFRENCH LAKEFRENCH LICKFRENCHGLENFRENCHTOWNFRENCHVILLEFRESH CREEKFRESNOFRIDAY HARBORFRIENDFRIENDLYFRIENDSHIPFRIENDSHIP (ADAMS) FRIENDSVILLEFRIENDSWOODFRIONAFRISCOFROGMOREFRONT ROYALFRONTENACFROSTPROOFFRUITLANDFRUITLAND PARKFRUITPORTFRY CANYONFRYEBURGFT MYERSFT VALLEYFT.WAYNEFULLERTONFULSHEARFULTONFULTONDALEFUNTER BAYFUQUAY / VARINAFUQUAY-VARINAGABBSGACKLEGADSDENGAFFNEYGAGEGAINESGAINESBOROGAINESVILLEGAITHERSBURGGALATIAGALAXGALAX HILLSVILLEGALBRAITH LAKEGALCHUTTGALENAGALESBURGGALESVILLEGALETONGALIEN TOWNSHIPGALIONGALLATINGALLATIN GATEWAYGALLIANOGALLIPOLISGALLUPGALLUPVILLEGALMEYGALTGALVESTONGALWAYGAMBELLGANADOGANSEVOORTGARAPANGARBERVILLEGARDEN CITYGARDEN RIDGEGARDEN VALLEYGARDENDALEGARDINERGARDNERGARDNERVILLEGARFIELDGARFIELD HEIGHTSGARLANDGARNERGARNETTGARRETTSVILLEGARRISONGARYGASPORTGASQUETGASTONGASTONIAGATESGATESVILLEGATEWAYGATZKEGAUTIERGAVILANGAYLORDGEARYGEIGERGEISMARGENESEOGENEVAGENOAGENTRYGEOGETOWNGEORGE TOWNGEORGE WESTGEORGETOWNGERALDINEGERLACHGERMANSVILLEGERMANTOWNGERONIMOGERRARDSTOWNGESSIEGETTYSBURGGHENTGIBSONGIBSON CITYGIBSONVILLEGIDDINGSGIDEONGIG HARBORGILA BENDGILBERTGILBERTSGILBOA / GRAND GORGEGILDFORDGILLESPIEGILLETTEGILLIAMGILLSVILLEGILMERGILROYGIRARDGIRDWOODGLACIER CREEKGLACIER VIEWGLAD VALLEYGLADE PARKGLADEWATERGLADSTONEGLADWINGLASCOGLASGOWGL ASSBOROGLASTONBURYGLEN ALLANGLEN BURNIEGLEN КАНЬОНА NATL ЗАП AREAGLEN Roseglen ST MARYGLEN ULLINGLENBURNGLENCOEGLENCROSSGLENDALEGLENDALE HEIGHTSGLENDALE / VOORHEESGLENDIVEGLENDOGLENDORAGLENEDEN BEACHGLENMORAGLENNALLENGLENNS FERRYGLENS FALLSGLENVIEWGLENWOODGLENWOOD SPRINGSGLIDEGLOBEGLOCESTERGLOUCESTERGLOUCESTER СУД HOUSEGLOUSTERGLUEKGNADENHUTTENGODDARDGODLEYGOESSELGOFFSGOFFSTOWNGOLD BEACHGOLD HILLGOLDENGOLDEN CITYGOLDEN РОГ LODGEGOLDEN MEADOWGOLDEN VALLEYGOLDENDALEGOLDFIELDGOLDSBOROGOLDSBYGOLDTHWAITEGOLIADGOLOVINGOLTSGOLVAGONVICKGONZALESGOOCHLANDGOODFIELDGOODHUEGOODINGGOODLANDGOODLETTSVILLEGOODMANGOODNEWSGOODNOWGOODRICHGOODYEARGOOSE BAYGOOSE CREEKGORDONGORDONSVILLEGORDONVILLEGOREGOREVILLEGORHAMGORINGORMANGORMAN / LANCASTERGOSHENGOSNELLGOSNOLDGOSPORTGOTHENBURGGOUVERNEURGOVEGOVERNORS HARBOURGOWANDAGRACEGRACEVILLEGRAFORDGRAFTONGRAHAMGRAIN VALLEYGRAINTONGRAINVILLEGRANBURYGRANBYGRAND CANYONGRAND CASEGRAND CHENIERGRAND COTEAUGRAND COULEEGRAND FORKSGRAND HAVENGRAND ISLANDGRAND ISLEGRAND СОЕДИНЕНИЯ GRAND LEDGEGRAND MARAISGRAND PAPIDSGRAND PRAIRIEGRAND RAPIDSGRAND SALINEGRAND TOWERGRANDFIELDGRANDINGRANDVIEWGRANDVILLEGRANDYGRANGERGRANGEVILLEGRANITEGRANITE CITYGRANITE FALLSGRANITE MOUNTAINGRANITE SHOALSGRANITEVILLEGRANTGRANT PARKGRANTHAMGRANTONGRANTSGRANTS PASSGRANTSBURGGRANTVILLEGRANVILLEGRAPELANDGRAPEVINEGRASMEREGRASONVILLEGRASS CREEKGRASS RANGEGRASS VALLEYGRASSFLATGRATISGRAVETTEGRAVOIS MILLSGRAYGRAYLANDGRAYLINGGRAYSLAKEGRAYTOWNGREAT BARRINGTONGREAT BENDGREAT FALLSGREAT MEADOWSGREAT VALLEYGREELEYGREEN BANKGREEN BAYGREEN CITYGREEN БУХТОЧКИ SPRINGSGREEN CREEKGREEN Rivergreen Seagreen VALLEYGREENBACKGREENBRIERGREENCASTLEGREENEGREENEVILLEGREENFIELDGREENLEAFGREENPORTGREENSBOROGREENSBURGGREENTOWNGREENVILLEGREENVILLE JUNCTIONGREENWATERGREENWICHGREENWOODGREENWOOD VILLAGEGREENWOOD / ЧУДО LAKEGREERGREERS FERRYGREGORYGRENADAGRENDRAGRENORAGRESHAMGRETNAGREYBULLGRIDLEYGRIFFINGRIFFITHGRIFFITHVILLEGRIGGSVILLEGRIMESGRIMESLANDGRINNELLGROESBECKGROTONGROTON (NEW LONDON) GROTTOESGROVEGROVE CITYGROVELANDGRO VETONGRUNDYGRUNDY CENTERGRUVERGRYGLAGUALALAGUALO RALGUAMGUAYNABOGUERNSEYGUEYDANGUFFEYGUIDE ROCKGULF BREEZEGULF SHORESGULFPORTGULKANAGUN BARREL CITYGUNNISONGUNTERSVILLEGURDONGURLEYGURNEEGUSTAVUSGUSTINEGUTHRIEGUTHRIE CENTERGUTTENBERGGUYGUYMONGUYTONGWINNGWINNERGYPSUMHACHITAHACKBERRYHACKENSACKHACKETTSTOWNHACKETTSTOWN / GREAT MEADOWSHADLEYHAGERSTOWNHAGUEHAHIRAHAHNVILLEHAILEYHAINESHAINES CITYHAINES JUNCTIONHAINESBURGHALEHALE CENTERHALES LOCATIONHALEYVILLEHALF MOON BAYHALFWAYHALIFAXHALLHALLETTSVILLEHALLIDAYHALLOCKHALLSHALLS CROSSINGHALLSVILLEHALSEYHALSTADHALSTEADHAM LAKEHAMBERGHAMBURGHAMDENHAMERSVILLEHAMILTONHAMLINHAMMONDHAMMONDSPORTHAMMONTONHAMPSHIREHAMPSTEADHAMPTONHAMPTONVILLEHANAHANALEIHANAMAULUHANAPEPEHANCEVILLEHANCOCKHANFORDHANKSVILLEHANNIBALHANNUM CREEKHANOVERHANOVER TOWNSHIPHANSONHANSVILLEHAPPY CAMPHAPPY CANYONHARAHANHARALSONHARBOR SPRINGSHARBORCREEKHARDINHARDINGHARDINSBURGHARDYHARETTAHARFORDHARKER HEIGHTSHARLANHARLEMHARLINGENHARLOWTONHARMONYHAROLDHARPERHARPERS FERRYHARPERSVILLEHARPSWELL HARRAHHARRIETTAHARRIMANHARRINGTONHARRISHARRISBURGHARRISONHARRISONBURGHARRISONVILLEHARRISVILLEHARRODSBURGHARROLDHARSENS ISLANDHARTHART / SHELBYHARTFORDHARTFORD CITYHARTINGTONHARTLANDHARTLAND TOWNSHIPHARTMANHARTSELHARTSELLEHARTSVILLEHARTWELLHARVARDHARVESTHARVEYHARVEY CEDARSHARWINTONHARWOODHASKELLHASLETHASTINGSHATBOROHATCHHATO REYHATTERASHATTIESBURGHATTIESBURG-LAURELHATTONHAUGHTONHAUSER LAKEHAVANAHAVELOCKHAVERHILLHAVERSTRAWHAVILANDHAVREHAVRE ДЕ GRACEHAWIHAWK INLETHAWK POINTHAWKINSHAWKINSVILLEHAWLEYHAWTHORNEHAXBYHAXBY / ФОРТ PECKHAXTUNHAY SPRINGSHAYDENHAYESHAYESVILLEHAYFORKHAYMARKETHAYSHAYTIHAYWARDHAZARDHAZARDVILLEHAZEL CRESTHAZEL GREENHAZELHURSTHAZELTONHAZENHAZLEHURSTHAZLETONHEADLANDHEADQUARTERSHEALDSBURGHEALDTONHEALYHEARNEHEBBRONVILLEHEBERHEBER CITYHEBER SPRINGSHEBRONHECKERHECTORHEDGESVILLEHELENAHELENA / ЗАПАД HELENAHELENDALEHELMERHEMETHEMINGFORDHEMLOCKHEMPHILLHEMPSTEADHENDERSONHENDERSONVILLEHENESSEYHENLYHENNEPINHENNESSEYHENNIKERHENNINGHENRIETTAHENRYHENRYETTAHERALDHERBSTERHEREFORDHERENDEEN Б.А. YHERINGTONHERKIMERHERLONGHERMANHERMANNHERMANVILLEHERMISTONHERMITAGEHERNANDOHERONHERREIDHERRINHERSHEYHERTFORDHESPERIAHESPERUSHESSELHESSMERHESSTONHETTINGERHEXTHEYWORTHHIALEAHHIAWATHAHIBBINGHICKMANHICKORYHICKORY CORNERSHICKORY VALLEYHICKSONHICOHIGBEEHIGDENHIGGINSHIGGINSVILLEHIGH FALLSHIGH ISLANDHIGH POINTHIGH SPRINGSHIGHGATEHIGHGATE SPRINGSHIGHLANDHIGHLAND HEIGHTSHIGHLAND PARKHIGHLANDSHIGHLANDS RANCHHIGHMOREHIGHTSTOWNHIGHWOODHILDRETHHILLHILL CITYHILLIARDHILLMANHILLSBOROHILLSBOROUGHHILLSDALEHILLSIDEHILLSVILLEHILLTOP LAKESHILLTOWNHILLVIEWHILMARHILOHILTONHILTON HEADHILTON ГОЛОВА ISLANDHINCHINBROOKHINCKLEYHINESTONHINESVILLEHINGHAMHINKLEYHINSDALEHINTONHIRAMHISEVILLEHITCHCOCKHOAGLANDHOBARTHOBBSHOBE SOUNDHOBGOODHOCKLEYHODGENVILLEHOFFMAN ESTATESHOGANSVILLEHOGATZAHOGELANDHOHENWALDHOLBROOKHOLCOMBHOLDENHOLDENVILLEHOLDINGFORDHOLDREGEHOLIDAY ISLANDHOLLANDHOLLANDALEHOLLIDAYHOLLISHOLLIS CENTERHOLLISTERHOLLISTONHOLLONVILLEHOLLYHOLLY GROVEHOLLY HILLHOLLY RIDGEHOLLY SPRINGSHOLLYWOODHOLMANSVILLEHOLMDELHOLMENH OLTHOLTONHOLTVILLEHOLY CROSSHOLYOKEHOMEHOMEDALEHOMERHOMERVILLEHOMESTEADHOMINYHOMOSASSAHONDOHONEA PATHHONEOYE FALLSHONESDALEHONEY GROVEHONOKAAHONOLULUHOOD RIVERHOOKERHOOKERTONHOOKSETTHOOKSTOWNHOONAHHOOPAHOOPERHOOPER BAYHOOPESTONHOOPLEHOOVERHOPEHOPEDALEHOPEWELLHOPEWELL JUNCTIONHOPKINSHOPKINSVILLEHOPKINTONHOQUIAMHORNELLHORNERSVILLEHORNICKHORSE CAVEHORSEHEADSHORSESHOE BAYHORSESHOE BENDHORSFELDHORSHAMHORTONHORTONVILLEHOSKINSHOT SPRINGSHOTCHKISSHOUGHTON LAKEHOUGHTON LAKE HEIGHTSHOULTONHOUMAHOUSTONHOVENHOWARDHOWARD LAKEHOWEHOWELLHOXIEHUACHUCA CITYHUACHUCA ГОРОД / TOMBSTONEHUBBARDHUBBARD LAKEHUDSONHUDSON LAKEHUDSONVILLEHUGHESHUGOHUGOTONHULBERTHULETTHUMACAOHUMBLEHUMBOLDTHUMESTONHUNTHUNTERHUNTERSVILLEHUNTINGBURGHUNTINGDONHUNTINGTONHUNTINGTON BEACHHUNTINGTON VALLEYHUNTLEYHUNTSVILLEHURDLANDHURDLE MILLSHURLEYHURLOCKHURONHURON TOWNSHIPHURRICANEHURSTHURTHURTSBOROHUSLIAHUSONHUSTISFORDHUSTONHUTCHINSONHUTTOHYAMPOMHYANNISHYDABURGHYDENHYDERHYDROHYEHYSHAMIBAPAHICY BAYICY CAPEIDAIDA GROVEIDABELIDAHOIDAHO CITYI Daho FALLSIDAHO SPRINGSIDALIAIDALOUIGIUGIGILIAMNAILLINOIS CITYILWACOIMMOKALEEIMNAHAIMPERIALIMPERIAL BEACHINAINDEPENDENCEINDEPENDENCE CREEKINDIAN CREEKINDIAN HEADINDIAN HILLINDIAN HILLSINDIAN LAKEINDIAN RIVERINDIAN SPRINGSINDIAN TRAILINDIANAINDIANAPOLISINDIANOLAINDIANTOWNINDIOINDUSTRYINEZINGALLSINGLESIDEINKOMINKSTERINLETINNISINOLAINTERCOASTAL CITYINTERIORINTERLACHENINTERLAKENINTERLOCHENINTERNATIONAL FALLSINTRACOASTAL CITYINVER GROVE HEIGHTSINVER GROVE HGTSINVERNESSINYOKERNIOLAIONEIONIAIOTAIOWAIOWA CITYIOWA КОЛОНИЯ / MANVELIOWA FALLSIPSWICHIRAANIREDELLIRMAIRON GATEIRON Маунтин-Айрон ГОРА KINGSFORDIRON RIVERIRONSIDEIRONTONIRONWOODIRVINEIRVINGIRVINGTONIRWINIRWINVILLEISABELISABELAISHPEMINGISLA DE CULEBRAISLA DE VIEQUESISLAMORADAISLAND GROVEISLAND HEIGHTSISLAND PARKISLAND PONDISLANDIAISLEISLE AU HAUTISLE LAMOTTEISLESBOROISSAQUAHITHACAIUKAIVAIVANHOEIVORIVYLANDJABOR Jaluit ATOLLJACKJACKMANJACKPOTJACKSBOROJACKSONJACKSON CENTERJACKSON LAKEJACKSONVILLEJACKSONVILLE BEACHJACKTOWNJACOBSONJACUMBAJAFF REYJAKOLOF BAYJALJAMAICA QUEENSJAMESBURGJAMESPORTJAMESTOWNJANESVILLEJARRELLJASONVILLEJASPERJAYJAYTONJAYUYAJEANJEANERETTEJEANNETTEJEFFERSJEFFERSONJEFFERSON CITYJEFFERSONVILLEJEKYLL ISLANDJELLICOJEMISONJENAJENISONJENKINSJENKINSVILLEJENNINGSJENSENJENSENSJERICHOJERMYNJEROMEJERSEYJERSEY CITYJERSEY SHOREJERSEY VILLAGEJERSEYVILLEJESSUPJESUPJETMOREJEWELLJEWETTJEWETT CITYJIGGERJOBSTOWNJOHN DAYJOHNSBURYJOHNSONJOHNSON BAYOUJOHNSON CITYJOHNSONVILLEJOHNSTOWNJOLIETJONESJONESBOROJONESBOROUGHJONESBURGJONESDALEJONESTOWNJONESVILLEJOPLINJORDANJORDAN VALLEYJOSEPHJOSHUAJOSHUA TREEJOURDANTONJULESBURGJULIANJUNCTIONJUNCTION CITYJUNEAUJUNO BEACHJUNTURAJUPITERJUSTICEBURGJUSTINKABETOGAMAKADOKAKAHLOTUSKAHOKAKAHUKUKAHULUIKAILUA / KONAKAISER / ОЗЕРО OZARKKAKEKAKTOVIKKALAKAKET CREEKKALAMAZOOKALAUPAPAKALISPELLKALKASKAKALSKAGKALTAGKAMIAHKAMPSVILLEKAMUELAKANABKANAKANAKKANARRAVILLEKANEKANEOHEKANEVILLEKANKAKEEKANNAPOLISKANSASKANSAS CITYKANSASVILLEKANTISHNAKAPLANKAPOLEIKAPOWSINKARLSTADKARLUKKARLUK LAKEKARNES CITYKASAANKASIGLUK KASILOFKATMAI НАЦИОНАЛЬНЫЙ PARKKATYKAUFMANKAUNAKAKAIKAUNEONGA LAKEKAVIK RIVERKAYCEEKAYENTAKEANSBURGKEARNEYKEARNYKEATON BEACHKECHIKEENEKEENESBURGKEITHVILLEKEKAHA, KAUAIKELLERKELLERS CHURCHKELLEYS ISLANDKELLIHERKELLOGGKELSOKEMMERERKEMPNERKEMPTONKENAIKENANSVILLEKENBRIDGEKENDALLKENDALLVILLEKENEDYKENILWORTHKENLYKENMAREKENMOREKENNARDKENNEBECKENNEBUNKPORTKENNEDALEKENNEDYKENNEDY MEADOWSKENNERKENNETTKENNETT SQUAREKENNEWICKKENOSHAKENSALKENSINGTONKENTKENT CITYKENTLANDKENTONKENTWOODKEOKUKKEOSAUQUAKERENSKERHONKSONKERMITKERNVILLEKERRICKKERRVILLEKERSEYKETCHIKANKETCHUMKETTERINGKETTLE FALLSKEWADINKEWANEEKEWANNAKEWAUNEEKEY LARGOKEY WESTKEYMARKEYSERKEYSTONEKEYSTONE HEIGHTSKEYSVILLEKEYTESVILLEKIANAKIDRONKILBOURNEKILGOREKILI ISLANDKILL ДЬЯВОЛА HILLSKILLDEERKILLEENKILLINGTONKILLONAKILMARNNOCKKILMARNOCKKIMAMAKIMBALLKIMBERLING CITYKIMBERLYKINCKERBOKERKINDERKINDREDKING CITYKING COUNTYKING COVEKING GEORGEKING SALMONKINGFISHERKINGMANKINGSKINGSBURYKINGSLANDKINGSPORTKINGSTONKINGSTREEKINGSTREEEKINGSVILLEKINGWOODKINGWOOD Т OWNSHIPKINSLEYKINSMANKINSTONKINZUAKIOWAKIPNUKKIPTONKIRBYVILLEKIRKKIRKERSVILLEKIRKLANDKIRKSVILLEKIRKWOODKIRWINKISSIMMEEKITEKITOI BAYKITTANNINGKITTITASKITTRELLKITZMILLERKIVALINAKLAMATH FALLSKLAMATH GLENKLAMATH RIVERKLAWOCKKLINGERSTOWNKLONDYKEKNIGHTDALEKNIGHTS LANDINGKNIGHTSENKNOB NOSTERKNOLLSKNOWLESVILLEKNOXKNOX CITYKNOXVILLEKOBLERVILLEKOBUKKODIAKKOKHANOKKOKOMOKOLIGANEKKONGIGANAKKOOSKIAKOSCIUSKOKOSRAEKOTLIKKOTZEBUEKOUNTZE / SILSBEEKOUTSKOYUKKOYUKUKKRALLTOWNKREMLINKREMMLINGKRESSKROTZ SPRINGSKRUMKULIK LAKEKULMKUNAKUPARUKKUTZTOWNKWAJALEINKWETHLUKKWIGILLINGOKKYLELA BELLELA CANADALA CENTERLA CROSSELA FONTAINELA GARITALA GRANDELA GRANGELA HARPELA JOLLALA JUNTALA LUZLA MESALA MOILLELA MOURELA PLACELA PLATALA POINTELA Портелы PORTE CITYLA PRYORLA SALLA SALLELA VERNELA VERNIALA веталы WARDLABELLELACASSINELACEYLACKAWAXENLACOMBELACONLACONIALACROSSELADYSMITHLAFAYETTELAFITTELAFOLLETTELAGARTOLAGO VISTALAGRANGELAGUNA HILLSLAGUNA PARKLAHAINALAHASKALAINGSBURGLAJASLAJITASLAKELAKE ANDESLAKE ARIELLAKE ARROWHE ADLAKE ARTHURLAKE BRONSONLAKE BUTLERLAKE CHARLESLAKE CITYLAKE DALLASLAKE ELSINORELAKE Forestlake FORKLAKE GENEVALAKE GEORGELAKE усаваХ CITYLAKE HUNTINGTONLAKE ISABELLALAKE JAMESLAKE LOUISELAKE MARYLAKE MILLSLAKE NEBAGAMONLAKE OSWEGOLAKE OZARKLAKE PANASOFFKEELAKE PARKLAKE PLACIDLAKE PRESTONLAKE PROVIDENCELAKE СЕН LOUISLAKE STEVENSLAKE TOMAHAWKLAKE VILLAGELAKE WALESLAKE WORTHLAKEFIELDLAKEHURSTLAKELANDLAKEPORTLAKESHORELAKESIDELAKEVIEWLAKEVILLELAKEWAYLAKEWOODLAKINLAKOTALAMARLAMARQUE / ТЕХАС CITYLAMBERTLAMBERTVILLELAMESALAMONILAMONTLAMPASASLANAILANAI CITYLANARKLANCASTERLAND О ‘LAKESLAND О’ LAKESLANDERLANDISLANDISBURGLANDMARKLAND-О-LAKESLANDOVERLANDRUMLANELANESVILLELANETTLANEVILLELANGDONLANGHORNELANGLEYLANGTRYLANSDALEL» ANSELANSFORDLANSINGLAONALAOTTOLAPAZLAPEERLAPINELAPORTELARAMIELARCHWOODLAREDOLARGELARGOLARIMORELARKSPURLARKSVILLE BOROUGHLARNEDLARSENLARSEN BAYLARUELAS ANIMASLAS CRUCESLAS VEGASLATEXOLATROBELAURALAURELLAURENSLAURIERLAURINBURGLAVA HOT SPRINGSLAVEENLAVINALAWINGLAWRENCELAWRENCEBU RGLAWRENCEVILLELAWSONVILLELAWTONLAYFAYETTELAYTONLAYTONSVILLELAZY BAYLE MARSLE Royle SUEURLEADLEADORELEADVILLELEAF RIVERLEAGUE CITYLEAKEYLEASBURGLEAVENWORTHLEBANONLECANTOLEDBETTERLEELEE VININGLEEDSLEEPERLEES SUMMITLEE’S SUMMITLEESBURGLEESVILLELEEVILLELEHILEHIGH ACRESLEHIGHTONLEICESTERLEIGHTONLEIPSICLEITCHFIELDLEMARSLEMMONLEMMON VALLEYLEMONTLEMOORELENALENAPAHLENOIRLENOIR CITYLENORALENOXLENWOODLEOLEO-CEDARVILLELEOMINSTERLEONLEONARDLEONARDTOWNLEOTILERAYSVILLELEROYLESLIELESTERLESTERVILLELETCHERLEVANTLEVELLANDLEVELOCKLEWISBURGLEWISPORTLEWISTONLEWISTOWNLEWISVILLELEXINGTONLEXINGTON PARKLEXINGTON / PRATTSVILLELEXINGTON-PARSONSLIBBYLIBERALLIBERTYLIBERTY HILLLIBERTYTOWNLIBERTYVILLELICKINGLIDGERWOODLIGONIERLIHUELIKELYLILLIANLILLINGTONLILLYLIMALIME VILLAGELIMERICKLIMESTONELIMINGTONLIMONLINCOLNLINCOLN CITYLINCOLN PARKLINCOLN UNIVERSITYLINCOLNTONLINDLINDENLINDENHURSTLINDRITHLINDSAYLINDSBORGLINDSTROMLINE LEXINGTONLINESVILLELINGLESTOWNLINNLINO LAKESLINTHICUM HEIGHTSLINTONLINVILLELINWOODLIONVILLELISBONLIT CHFIELDLITHIALITHIA SPRINGSLITHONIALITITZLITTLE ELMLITTLE FALLSLITTLE FERRYLITTLE RIVERLITTLE ROCKLITTLE САХАРЕ РЕКРЕАЦИЯ AREALITTLE YORKLITTLEFIELDLITTLEFORKLITTLESTOWNLITTLETONLIVE OAKLIVENGOODLIVERMORELIVERMORE FALLSLIVERPOOLLIVINGSTONLIVONIALIZTONLLANOLOALOAMILOCK HAVENLOCKHARTLOCKNEYLOCKPORTLOCKRIDGELOCKWOODLOCUSTLOCUST GROVELODILOGANLOGANSPORTLOGANVILLELOHRVILLELOMA LINDALOMETALOMPOCLONDONLONDONDERRYLONE GROVELONE JACKLONE OAKLONE PINELONE ROCKLONE TREELONE WOLFLONELYLONG BARNLONG BEACHLONG CREEKLONG GREENLONG ISLANDLONG LAKELONG PONDLONG PRAIRIELONG VALLEYLONGBRANCHLONGMONTLONGVIEWLONGVILLELONOKELOOKOUT MOUNTAINLOPEZLOPEZ ISLANDLORAIN / ELYRIALORANGERLORDSBURGLORDSTOWNLORETTOLORIDALORINGLORISLOS ALAMITOSLOS ALAMOSLOS ANGELESLOS АНДЖЕЛЕС / VAN NUYSLOS BANOSLOS FRESNOSLOS LUNASLOST HILLSLOTTLOTUSLOUDENVILLELOUDONLOUDONVILLELOUISALOUISANALOUISBURGLOUISELOUISIANALOUISVILLELOUP CITYLOVEJOYLOVELANDLOVELOCKLOVETTSVILLELOVINGLOVINGSTONLOVINGTONLOW MOORLOWELLLOWMANLOWPOINTLOXAHATCHEELOXLEYLU BBOCKLUBECLUCASLUCASVILLELUCCALUCEDALELUCERNE VALLEYLUCILELUCINLUDINGTONLUDLOWLUFKINLUGOFFLULINGLUMBERTONLUMPKINLUNDLUNDELLLURAVILLELURAYLUSBYLUSKLUSTRELUTCHERLUTHERLUTHERSVILLELUTZLUVERNELUXEMBURGLUZERNELYDIALYLESLYMANLYMELYNCHLYNCHBURGLYNDENLYNDONLYNDONVILLELYNNLYNWOODLYONSLYSITEMACCLENNYMACDOELMACEDONMACHIASMACHIPONGOMACKMACKAYMACKEYVILLEMACKINAC ISLANDMACKINAWMACKSVILLEMACOMBMACONMADDOCKMADELIAMADERAMADILLMADISONMADISONVILLEMADRASMADRIDMAGDALENAMAGEEMAGNOLIAMAGNOLIA SPRINGSMAHANOYMAHNOMENMAHONEY CREEKMAHWAHMAIDENMAIDEN ROCKMAINVILLEMAJURO ATOLLMALAD CITYMALAKOFFMALDENMALIBUMALINMALONEMALTAMALVERNMAMMOTH LAKESMAMOUMANAHAWKINMANASSASMANCELONAMANCHESTERMANCHESTER-By-The SEAMANDANMANGONIA PARKMANGROVE CAYMANGUMMANHASSETMANHATTANMANILAMANISTEEMANISTIQUEMANITOMANITOWISH WATERSMANITOWOCMANKATOMANKOMEN LAKEMANLEY ГОРЯЧИЙ SPRINGSMANLIUSMANNBOROMANNINGMANOKOTAKMANQUINMANSFIELDMANTECAMANTENOMANTEOMANTIMANTONMANTUAMANVELMANVILLEMANYMANZANITAMAPLE CITYMAPLE GROVEMAPLE HILLMAPLE LAKEMAPLE PARKMAPLE PLAINMAPLESMAPLESVILLEMAPLETONMAQUOKETAMARANAMARATHONMARBLEMARBLE CANYONMARBLE FALLSMARCELINEMARCELLMARCELLUSMARCO ISLANDMARCUSMARCYMARDELA SPRINGSMARENGOMARFAMARIANNAMARIBELMARICOPAMARIENVILLEMARIETTAMARINAMARINA DEL REYMARINE CITYMARINETTEMARINGOUINMARIONMARION CENTERMARION / WYTHEVILLEMARIPOSAMARISSAMARK CENTERMARKED TREEMARKESANMARKHAMMARKLEEVILLEMARKLEVILLEMARKSMARKSVILLEMARLBOROMARLBOROUGHMARLETTEMARLINMARLOWMARLTONMARQUETTEMARQUEZMARREROMARSMARS HILLMARSEILLESMARSH HARBOURMARSHALLMARSHALLTOWNMARSHFIELDMARSHVILLEMARSINGMARSTON MILLSMARSTONS MILLSMARTINMARTINS CREEKMARTINSBURGMARTINSVILLEMARVELLMARY ESTHERMARYDELMARYSVILLEMARYVILLEMASCOTTEMASHANTUCKETMASHPEEMASONMASON CITYMASONTOWNMASONVILLEMASSENAMASSETMASSEYMASSILLONMATADORMATAGORDAMATHESONMATHEWSMATINICUS ISLANDMATOACAMATTAWAMATTAWANMATTHEW TOWNMATTHEWSMATTITUCKMATTOONMATTOON / CHARLESTONMAUMEEMAUPINMAURERTOWNMAURICEMAUSTONMAXMAXBASSMAXTONMAXWELLMAYMAY CREEKMAYAGUEZMAYBEEMAYFIELDMAYFIELD HEIGHTSMAYFLOWERMAYLANDMAYNARDMAYOMAYPEARLMA YPORTMAYS LANDINGMAYSVILLEMAYVILLEMAYWOODMAZAMAMAZONMC ADOOMC ALESTERMC ALISTERMC ALLENMC ALPINMC ARTHURMC CALLMC CAMEYMC CANNAMC CAUSLANDMC CLEARYMC CLELLANDTOWNMC CLENDON-CHISHOLMMC CLUSKYMC COMBMC CONNELSVILLEMC COOKMC КУК / CULBERTSONMC CORMICKMC COYMC CRORYMC DERMITTMC DONALDMC GEHEEMC GREGORMC HENRYMC INTOSHMC KEANMC KENZIEMC Kenzie BRIDGEMC KINNEYMC KINNONMC LAUGHLINMC LEANMC LEANSBOROMC LOUTHMC MINNVILLEMC NEILMC PHERSONMC RAEMC VILLEMCCALLMCCARTHYMCCLELLANVILLEMCCOMBMCCONNELLSBURGMCDANIELSMCDONALDMCGAHEYSVILLEMCGRATHMCGREGORMCKINLEY PARKMCKINNEYMCLEANMCMINNVILLEMCNEALMEADMEADEMEADOW CREEKMEADOW LAKESMEADVIEWMEADVILLEMEARSMECHANICSBURGMECKLENBURGMECOSTAMEDARYVILLEMEDDYBEMPSMEDFORDMEDIAMEDIAPOLISMEDICAL LAKEMEDICINE BOWMEDICINE LODGEMEDINAMEDLEYMEEKERMEETEETSEMEGGETTMEJIT ATOLLMEKORYUKMELBETAMELBOURNEMELFAMELROSEMELROSE PARKMELVILLEMELVINMEMPHISMENAMENARDMENDONMENDOTAMENLO PARKMENNOMENOMENOKENMENOMINEEMENOMONEE FALLSMENOMONIEMENTONEMEQUONMER ROUGEMERCEDMERCEDESMERCERMERCHANTVILLE MERCURYMEREDITHMERIDALEMERIDENMERIDIANMERIGOLDMERITMERLINMERNAMEROMMERRIAMMERRILLMERRILLVILLEMERRIMACMERRIMACKMERRIMANMERRITT ISLANDMERTARVIKMERTZONMESAMESHOPPENMESQUITEMETAIRIEMETALINE FALLSMETHUENMETLAKATLAMETOLIUSMETROPOLISMETTERMEXIAMEXICAN HATMEXICOMEYERS CHUCKMEYERSDALEMIAMIMIAMI BEACHMIAMISBURGMICANOPYMICCOSUKEEMICHIGAN CITYMICOMIDDLE BASS ISLANDMIDDLE RIVERMIDDLEBOROUGHMIDDLEBURGMIDDLEBURG HEIGHTSMIDDLEBURGHMIDDLEBURYMIDDLEFIELDMIDDLESBOROMIDDLESEXMIDDLETONMIDDLETON ISLANDMIDDLETOWNMIDDLEVILLEMIDLANDMIDLOTHIANMIDLOTHIAN / WAXAHACHIEMIDVALEMIDVILLEMIDWAYMIDWAY ATOLLMIDWESTMIDWEST CITYMIFFLINBURGMIFFLINTOWNMILACAMILANMILANOMILBANKMILBURNMILDREDMILES CITYMILFORDMILFORD CENTERMILI ISLANDMILL HALLMILLBROOKMILLBURYMILLCREEKMILLEDGEVILLEMILLENMILLERMILLERSBURGMILLERSVILLEMILLERTONMILLICANMILLIKENMILLINGTONMILLINOCKETMILLISMILLSAPMILLSTADTMILLVILLEMILNERMILNORMILTONMILTON / FREEWATERMILWAUKEEMIMBRESMINAMINCHUMINAMINDENMINEOLAMINEOLA / QUITMANMINERALMINERAL POINTMINERAL SPRINGSMINERAL WELLSMI NERSVILLEMINERVAMINIDOKAMINIERMINNEAPOLISMINNEOLAMINNESOTA LAKEMINOCQUA-WOODRUFFMINONGMINONKMINOOKAMINOTMINTOMIOMIRANDO CITYMISHAWAKAMISSIONMISSION VIEJOMISSOULAMISSOURI CITYMISSOURI VALLEYMITCHELLMOABMOBERLYMOBILEMOBRIDGEMOCKSVILLEMODENAMODESTOMODOCMOFFATMOHALLMOHAVE VALLEYMOHAWKMOJAVEMOKULEIAMOLALLAMOLINEMOMENCEMONAHANSMONAVILLEMONCHESMONCKS CORNERMONDOVIMONEEMONETAMONETTMONHEGANMONHEGAN ISLANDMONMOUTHMONONAMONONGAHELAMONROEMONROE CITYMONROEVILLEMONROVIAMONT BELVIEUMONT VERNONMONTAGUEMONTANA CREEKMONTAUKMONTE VISTAMONTELLOMONTEREYMONTEVALLOMONTEVIDEOMONTEZUMAMONTGOMERYMONTGOMERY CITYMONTICELLOMONTMORENCIMONTOUR FALLSMONTOURSVILLEMONTPELIERMONTROSEMONTROSSMONTVILLEMONUMENTMONUMENT VALLEYMOODYMOORCROFTMOOREMOORE CREEKMOORE HAVENMOORELANDMOORES HILLMOORESTOWNMOORESVILLEMOORHEADMOORPARKMOOSE КРИК RANGER STATIONMOOSE LAKEMOOSE PASSMOOSICMORAMORANMORAVIAMOREAUVILLEMOREHEADMORELANDMORELAND HILLSMORENO VALLEYMORGANMORGAN CITYMORGANFIELDMORGANTONMORGANTOWNMORIARTYMORRILTONMORRISMORRIS РАВНИННОЙ МОРРИС TOWNSHIPMORRISONMORRISONVILLEMORRISTONMORRISTOWNMORRISVILLEMORROWMORSE BLUFFMORTONMOSBYMOSCOWMOSCOW MILLSMOSER BAYMOSES LAKEMOSHEIMMOSINEEMOSQUEROMOSSYROCKMOTLEYMOTTMOULTONMOULTONBOROMOULTONBOROUGHMOULTRIEMOUNDMOUND CITYMOUNDRIDGEMOUNDSMOUNDSVILLEMOUNDVILLEMOUNT AIRYMOUNT AYRMOUNT CARMELMOUNT CARROLLMOUNT CLEMENSMOUNT DORAMOUNT GILEADMOUNT HOLLYMOUNT HOODMOUNT HOPEMOUNT HOREBMOUNT IDAMOUNT JOYMOUNT РАДОСТЬ / MARIETTAMOUNT LAURELMOUNT MORRISMOUNT OLIVEMOUNT ORABMOUNT PLEASANTMOUNT POCONOMOUNT PRINCETONMOUNT SELMANMOUNT SOLONMOUNT STERLINGMOUNT СТЕРЛИНГОВОГО / OWINGSVILLEMOUNT VERNONMOUNT VICTORYMOUNTAINMOUNTAIN CITYMOUNTAIN GROVEMOUNTAIN HOMEMOUNTAIN SPRINGSMOUNTAIN VIEWMOUNTAIN VILLAGEMOUNTAINAIRMOUNTVILLEMOWEAQUAMOYOCKMT AYRMT HOREBMT PLEASANTMT STERLINGMT VERNONMT VIEWMT .BETHELMT. НАДЕЖДА. ПРИЯТНО. VERNONMUD LAKEMUENSTERMULBERRYMULBERRY GROVEMULDOONMULE CREEKMULE КРИК JUNCTIONMULESHOEMULLENMULLIKENMULLINMUNCIEMUNCYMUNDAYMUNDELEINMUNISINGMUNSONMUNSTERMURCHISONMURDOMURDOCKMURFREESBOROMURFREESBURGMURPHYMURPHYSBOROMURRAYMURRAYVILLEMURRIETAMURRIETA / TEMECULAMURRY SPURMURRYSVILLEMUSCATINEMUSCLE SHOALSMUSKEGET ISLANDMUSKEGONMUSKOGEEMUSKOKAMYERSTOWNMYRTLE BEACHMYRTLE CREEKMYSTICNAALEHUNABESNANACOGDOCHESNAGS HEADNAHUNTANAKEENNAKNEKNAMORIK ATOLLNAMPANANAIMONANCY LAKENANGATUCKNANJEMOYNANTUCKETNANWALEKNAPANAPAIMUTENAPAKIAKNAPASKIAKNAPAVINENAPERVILLENAPLESNAPOLEONNAPOLEONVILLENAPPANEENARA VISANARYNASELLENASHPORTNASHUANASHVILLENASSAUNASSAU BAYNATCHEZNATCHITOCHESNATICKNATRONA HEIGHTSNATURAL BRIDGE STATIONNATURITANAUVOONAVAJO DAMNAVAJO ГОРА TRDNG POSTNAVARRENAVASOTANAYLORNAZARETHNEAH BAYNEBONEBRASKA CITYNECEDAHNEEDHAMNEEDLESNEEDVILLENEENAHNEILLSVILLENEKOOSANELIGHNELLYSFORDNELSONNELSON COUNTYNELSON LAGOONNEMAHANEMONENANANEODESHANEOGANEOSHONEPHINEPTUNENESHANICNESHKORONESS CITYNEVADANEW ALBANYN EW ALEXANDRIANEW ATHENSNEW AUBURNNEW BALTIMORENEW BEDFORDNEW BERLINNEW BERNNEW BIGHTNEW BLOOMFIELDNEW BOSTONNEW BRAINTREENEW BRAUNFELSNEW BREMENNEW BRIGHTONNEW BRITAINNEW BRUNSWICKNEW CARLISLENEW CARROLLTONNEW CASTLENEW CHURCHNEW CUMBERLANDNEW CUYAMANEW DOUGLASNEW DURHAMNEW GALILEENEW GLOUCESTERNEW GULFNEW HAMPTONNEW HARMONYNEW HAVENNEW HILLNEW HOLSTEINNEW HOPENEW HUDSONNEW IBERIANEW KINGSTONNEW KINGSTOWNNEW LEBANONNEW LENOXNEW LEXINGTONNEW LISBONNEW LONDONNEW MADRIDNEW MARKETNEW MARTINSVILLENEW MEADOWSNEW MEMPHISNEW MILFORDNEW ORLEANSNEW OXFORDNEW PALTZNEW PHILADELPHIANEW PORT RICHEYNEW PRAGUENEW RAYMERNEW RICHMONDNEW ROADSNEW ROCKFORDNEW СМИРНА BEACHNEW STUYAHOKNEW TOWNNEW TRIERNEW ULMNEW WASHINGTONNEW WAVERLYNEW WHITELANDNEW WILMINGTONNEW WINCHESTERNEW WINDSORNEW YORKNEW YORK MILLSNEWARKNEWBERGNEWBERRYNEWBORNNEWBURGNEWBURGHNEWBURYNEWBURY PARKNEWBURYPORTNEWCASTLENEWELLTONNEWFANENEWFOUNDLANDNEWHALEMNEWHALLNEWMAN LAKENEWMANSTOWNNEWNANNEWPORTNEWPORT BEACHNEWPORT NEWSNEWRYNEWTOKNEWTONNEW TON FALLSNEWTON GROVENEWTOWNNEWTOWN SQUARENEWVILLENEZPERCENIAGARA FALLSNICEVILLENICHOLASVILLENICHOLLS TOWNNICOLLETNIELSVILLENIGHTMUTENIKISHKANIKISKINIKOLAINIKOLSKINILESNINE МИЛЕ FALLSNINEVEHNINILCHIKNINNEKAHNIOTANISSWANIWOTNOATAKNOBLESVILLENOCONANOGALESNOKOMISNOMENONNONDALTONNOORVIKNORA SPRINGSNORCROSS / Millinocket / NORDMANNORFOLKNORMANORMALNORMANNORMANGEENORRIDGEWOCKNORRISNORRISTOWNNORTHNORTH ADAMSNORTH ATTLEBOROUGHNORTH BALTIMORENORTH БАС ISLANDNORTH BAYNORTH BENDNORTH BERGENNORTH BERWICKNORTH BRANCHNORTH CANAANNORTH CANTONNORTH CAPENORTH COLLINSNORTH CONWAYNORTH CREEKNORTH DARTMOUTHNORTH EASTNORTH ELEUTHERANORTH FORKNORTH ЛИС ISLANDNORTH HAVENNORTH HERONORTH JACKSONNORTH КАНЗАС CityNorth KINGSTOWNNORTH ЛАС VEGASNORTH LIBERTYNORTH LIMANORTH МЕНЬШИЙ ROCKNORTH LIVERMORENORTH MANKATONORTH МАЙАМИ БИЧ-НОРТ-МАСКЕГОН-НОРТ-МИРТЛ-БИЧ-НОРТ-ОЛМСТЭД-НОР-ПЛАЙНС-НОР-ПЛАТТЕНОРТ ПОЛИНОРТ-ПОРТ-НОРТ-ПРЕРИЕНОРТ-РИЧЛЕНД-ХИЛЛС-НОРТ СОЛЬ ЛЕЙКЕНОРТ-САН-ЮАННОРТ-ШОРЕНОРТ-СЮКС-СИТИНОРТ DNORTH TARRYTOWNNORTH TROYNORTH VERNONNORTH WALESNORTH WEBSTERNORTH WHITEFIELDNORTH WILDWOODNORTH WILKESBORONORTH WINDHAMNORTH YARMOUTHNORTHAMPTONNORTHFIELDNORTHOMENORTHPORTNORTHUMBERLANDNORTHWAYNORTHWOODNORTONNORWALKNORWAYNORWICHNORWOODNOTTINGHAMNOVATONOVELTYNOVINOWATANUCLANUGGET BENCHNUIQSUTNULATONUMIDIANUNAM IQUANUNAPITCHUKNUNICANUNNNYACNYSSAOAK BLUFFSOAK BROOKOAK CREEKOAK GROVEOAK HARBOROAK HILLOAK ISLANDOAK PARKOAK RIDGEOAKDALEOAKESOAKESDALEOAKHILLOAKLANDOAKLAND TOWNSHIPOAKLEYOAKRIDGEOAKTOWNOAKVILLEOAKWOODOBERLINO’BRIENOCALAOCALA / BELLEVIEWOCEAN CITYOCEAN ОСТРОВ BEACHOCEAN PARKOCEAN SHORESOCEAN SPRINGSOCEANOOCEANSIDEOCEANWAYOCHOPEEOCILLAOCOEEOCONOMOWOCOCONTOOCONTO FALLSOCOTILLOOCOTILLO WELLSOCRACOKEODENVILLEODESSAOELRICHSOELRICH’SOELWEINO’FALLONOFU VILLAGEOGALLALAOGDENOGDENSBURGOHATCHEEOHIOOHIOPYLEOIL CITYOILTONOJAIOJIBWAOKANOGANOKARCHEOKEECHOBEEOKEENEOKEMAHOKLAHOMA CITYOKLAWAHAOKMULGEEOKOLONAOLATHEOLCOTTOLD BOSTONOLD BRIDGEOLD CROWOLD FORGEOLD HARBOROLD LYMEOLD MONROEOLD OCEANOLD ИЛИ Мангольдом BEACHOLD RIPLEYOLD TOWNOLD WASHINGTONOLDTOWNOLEANOLGA BAYOLIVE BRANCHOLIVE HILLOLIVER SPRINGSOLIVIAOLLAOLNEYOLNEY-NOBLEOLSBURGOLTONOLUSTEEOLYMPIAOLYMPIA FIELDSOLYPHANTOMAHAOMAKONAGAONALASKAONAMIAONANCOCKONAWAONAWAYONEIDAO’NEILLONEONTAONIDAONLEYONOONONDAGAONTARIOONTONAGONOOLAGAHOOLOGAHOOSTBURGOPALOPELIKAOPELOUSASOPHEIMOPHIRORANGEORANGE CITYORANGE GROVEORANGE PARKORANGE SPRINGSORANGEBURGORANGEFIELDORANGETOWNORANJESTADORBISONA / ROCKHILLORCHARDORCHARD LAKEORDORDWAYOREGONOREGON CITYOREMORFORDORFORDVILLEORIENTORISKAORLANDORLANDOORLANDO / Буэна VISTAORLEANSORMONDORMOND BEACHOROCOVISOROFINOOROGRANDEORONDOORONOORONOCOOROVILLEORRORRVILLEORSONORTONVILLEORWIGSBURGOSAGEOSAGE BEACHOSAGE CITYOSBORNOSBORNEOSCEOLAOSCEOLA MILLSOSCODAOSHAWAOSHKOSHOSKALOOSAOSSEOOSSIANOSSININGOSTEENOSTEROSTERBURGOSTERVILLEOSWEGOOTHELLOOTISOTSEGOOTTAWAOTTERBEINOTTUMWAOUR TOWNOURAYOUZINKIEOVERBROOKOVERGAARDOVERLAND PARKOVERTONOVIDOVIEDOOVILLAOWASSOOWATONNAOWEGOOWEN SOUNDOWENS CROSSROADSOWENSBOROOWENSVILLEOWENTONOWINGS MIL LSOWOSSOOWYHEEOXBOW VILLAGEOXFORDOXNARDOXON HILLOYSTER BAYOZARKOZONAPAAUILOPACEPACIFIC CITYPACKWOODPACOIMAPADUCAHPAGEPAGELANDPAGO PAGOPAGOSA SPRINGSPAHALAPAHOKEEPAHRUMPPAIGEPAINESVILLEPAINT LICKPAINT ROCKPAINTERPAINTSVILLEPAISLEYPALACIOSPALATKAPALESTINEPALISADEPALISADESPALM BAYPALM БИЧ GARDENSPALM COASTPALM DESERTPALM HARBORPALM SPRINGSPALMDALEPALMERPALMERTONPALMETTOPALMVIEWPALMYRAPALMYRA ОСТРОВ ATOLLPALO ALTOPALO PINTOPALO VERDEPALOMAPALOMINASPALOS HEIGHTSPALOUSEPAMPAPANAPANACAPANACEAPANAMAPANAMA CITYPANAMA ГОРОД BEACHPANDALEPANGUITCHPANHANDLEPANTONPAOLAPAOLIPAONIAPARACHUTEPARADISEPARAGONPARAGONAHPARAGOULDPARCHMENTPARISPARIS / Subiaco / ПАК Citypark FALLSPARK RAPIDSPARK RIDGEPARK RIVERPARKERPARKER DAMPARKER FORDPARKERS CORNERSPARKERSBURGPARKSPARKSLEYPARKSTONPARKTONPARMAPARNELLPAROWANPARRISHPARSHALLPARSIPPANNYPARSIPPANY-ТРОЙ HILLSPARSONSPASADENAPASCAGOULAPASCHALLPASCOPASO ROBLESPASS CHRISTIANPASSADUMKEAGPATCHOGUEPATERSONPATOKAPATRICK SPRINGSPATTENPATTENBURGPATTERSONPATTISONPATUXENT RIVE RPAULDENPAULDINGPAULLINAPAULS VALLEYPAUMA VALLEYPAW PAWPAWHUSKAPAWLINGPAWNEEPAWNEE CITYPAWTUCKETPAXSONPAXTONPAYETTEPAYNESVILLEPAYSONPEABODYPEACH SPRINGSPEAR VALLEYPEARCEPEARISBURGPEARL CITYPEARL HARBORPEARL RIVERPEARLANDPEARSALLPECAN ISLANDPECATONICAPECOSPEDRICKTOWNPEDRO BAYPEEBLESPEEKSKILLPEGGSPEIRRONPEKINPELAHATCHIEPELEE ISLANDPELHAMPELICANPELICAN RAPIDSPELIONPELL CITYPELLAPELLSTONPEMBERTONPEMBINAPEMBINEPEMBROKEPEMBROKE PINESPEN ARGYLPENCE SPRINGSPENDERPENDLETONPENN YANPENNINGTONPENNSAUKENPENNSBURGPENROSEPENSACOLAPENTICTONPEOAPEORIAPEOTONEPEPINPEPPER PIKEPEPPERELLPEQUANNOCKPEQUOT LAKESPERALTAPERDIDOPERDIDO BEACHPERDIDO KEYPERHAMPERKASIEPERRISPERRYPERRY ISLANDPERRYOPOLISPERRYSBURGPERRYTONPERRYVILLEPERTHPERUPESOTUMPETALPETALUMAPETERBOROPETERBOROUGHPETERSBURGPETOSKEYPETTYPEYTONPHENIX CITYPHILADELPHIAPHILIPPHILIPPIPHILIPSBURGPHILLIPSPHILLIPSBURGPHOENIXPHOENIXVILLEPICABOPICACHOPICAYUNEPICKENSPICKTONPIE TOWNPIEDMONTPIERMONTPIERREPIERSONPIERZPIGEON FORGEPIGGOTTPIKE ROADPIKEVILLEPILOT GROVEP Ilot MOUNTAINPILOT POINTPILOT ROCKPILOT STATIONPIMAPINCHER CREEKPINCKARDPINCKNEYVILLEPINCONNINGPINEPINE BLUFFPINE BLUFFSPINE GROVEPINE ISLANDPINE ОСТРОВ CENTERPINE KNOTPINE MOUNTAINPINE RIDGEPINE RIVERPINE SPRINGSPINE VALLEYPINE VILLAGEPINECREEKPINEDALEPINEHURSTPINEHURST / ЮЖНОЕ PINESPINELANDPINELLAS PARKPINETOPSPINEVIEWPINEVILLEPINK HILLPINSONPIPE CREEKPIPER CITYPIPERSVILLEPIPESTONEPIQUAPISCATAWAYPISECOPISEKPISGAHPITMANPITT MEADOWSPITTSBOROPITTSBURGPITTSBURGHPITTSFIELDPITTSGROVEPITTSTON FARMPITTSTOWNPITTSVILLEPLACERVILLEPLACIDAPLAIN CITYPLAINFIELDPLAINSPLAINVIEWPLAINVILLEPLAINWELLPLANADAPLANOPLANT CITYPLANTERSVILLEPLAQUEMINEPLATINUMPLATO CENTERPLATTEPLATTE CITYPLATTEVILLEPLATTSBURGPLATTSBURGHPLATTSMOUTHPLAYASPLAZAPLEASANT GARDENPLEASANT GROVEPLEASANT HILLPLEASANT HOMEPLEASANT PRAIRIEPLEASANTONPLEASANTVIEWPLEASANTVILLEPLEASUREVILLEPLENTYWOODPLOVERPLUCKEMINPLUMPLUMVILLEPLYMOUTHPLYMOUTH / CANTONPOCAPOCAHONTASPOCATELLOPOCOMOKEPOCOMOKE CITYPOCONO LAKEPOHNPEI ISLANDPOINCIANAPOINTPOINT BAKERP OINT CEDARPOINT COMFORTPOINT HOPEPOINT LAYPOINT MACKENZIEPOINT PLEASANTPOINT ROBERTSPOLACCAPOLARPOLEBRIDGEPOLK CITYPOLLARDPOLLOCKPOLLOCKSVILLEPOLOPOLSONPOMEROYPOMFRETPOMONAPOMONA PARKPOMPANO BEACHPONCAPONCA CITYPONCEPONCHATOULAPOND CREEKPONDERPONSFORDPONTIACPONTOOSUCPONTOTOCPOOLVILLEPOPE VALLEYPOPLARPOPLAR BLUFFPOPLAR GROVEPOPLARVILLEPORT ALEXANDERPORT ALICEPORT ALLEGANYPORT ALLENPORT ALSWORTHPORT ANGELESPORT ARANSASPORT ARTHURPORT AUSTINPORT BAILEYPORT BARREPORT BOLIVARPORT CANAVERALPORT CHARLOTTEPORT CLARENCEPORT CLINTONPORT FOURCHONPORT GIBSONPORT GRAHAMPORT HADLOCKPORT HARDYPORT HEIDENPORT HURONPORT ISABELPORT JERVISPORT LAVACAPORT LIONSPORT MANSFIELDPORT MATILDAPORT NELSONPORT O’CONNORPORT ИЗ DEL BONITAPORT ORCHARDPORT PROTECTIONPORT ROYALPORT ST JOEPORT ST LUCIEPORT ST.JOEPORT ST. LUCIEPORT SULPHURPORT TOWNSENDPORT WALTERPORT WASHINGTONPORT WILLIAMSPORTAGEPORTAGE CREEKPORTAGE LAKEPORTAGEVILLEPORTALPORTALESPORTERSVILLEPORTERVILLEPORTHILLPORTLANDPORTLAND-MULINOPORTSMOUTHPOSENPOSEYVILLEPOSTPOST FALLSPOST MILLSPOSTVILLEPOTEAUPOTEETPOTOSIPOTSDAMPOTTSBOROPOTTSTOWNPOTTSVILLEPOUGHKEEPSIEPOULSBOPOUNDPOWAYPOWELLPOWELL BUTTEPOWELL RIVERPOWERSPOWHATANPOY SIPPIPOYNORPRAGUEPRAIRIEPRAIRIE CITYPRAIRIE DU DU CHIENPRAIRIE SACPRAIRIE FARMPRAIRIE HILLPRAIRIE HOMEPRAIRIE VIEWPRAIRIEVILLEPRATTPRATTVILLEPREMONTPRENTICEPRENTISSPRESCOTTPRESCOTT VALLEYPRESHOPRESIDIOPRESQUE ISLEPRESTONPRESTONSBURGPRICEPRIDEPRIEST RIVERPRIMGHARPRINCE FREDERICKPRINCE RUPERTPRINCESS ANNEPRINCETONPRINCETON / СКАЛИСТЫЕ HILLPRINEVILLEPRIOR LAKEPRITCHETTPROCTORPROSPECTPROSPECT CREEKPROSPERPROSSERPROVIDENCEPROVIDENCIALESPROVINCETOWNPROVOPRUDHOE BAY / DEADHORSEPRYORPUEBLOPUEBLO WESTPUERTO NUEVOPUHIPULASKIPULLMANPULLMAN / MOSCOWPUNKIN CENTERPUNTA GORDAPUNTZI MOUNTAINPUNXSUTAWNEYPURCELLPURCELLVILLEPURDONPURDYPURKEYPILEPURVISP UT В BAYPUTNAMPUTNEYPUYALLUPPYLESVILLEQAANAAQQUAIL CREEKQUAKER CITYQUAKER STREETQUAKERTOWNQUANAHQUANTICOQUARRYVILLEQUARTZ CREEKQUARTZSITEQUEBECQUEEN CITYQUEEN CREEKQUEENSTOWNQUEMADOQUESTAQUILCENEQUILLAYUTEQUINCYQUINHAGAKQUINLANQUINTERQUINTONQUITAGUEQUITMANRACELANDRACINERADCLIFFERADFORDRADIP CITYRADNORRAEFORDRAGLEYRAHWAYRAIFORDRAILROAD FLATRAINELLERAINIERRAINY PASSRALEIGHRALEIGH / DURHAMRALLSRAMAHRAMONARAMPARTRAMSEURRAMSEYRANCHO MIRAGERANCHO MURIETARANCHO САНТА MARGARITARANCOCASRANDALLRANDLERANDLETTRANDOLPHRANGELEYRANGELYRANGERRANGLEYRANKINRANSONRANTOULRAPID CITYRAPID RIVERRATONRAVENDALERAVENNARAVENSWOODRAVIARAWLINSRAYRAYMONDRAYMOND TOWNSHIPRAYMONDVILLERAYNERAYVILLERAYWOODREADINGREADING CENTERREADINGTONREALITOSREARDANRECTORRED BANKSRED BLUFFRED BUDRED CLOUDRED CREEKRED DEVILRED DOGRED ПЕРО LAKESRED HOOKRED ОЗЕРО FALLSRED LODGERED OAKRED RIVERRED SPRINGSRED WINGREDANREDDICKREDDINGREDFIELDREDGRANITEREDHOUSEREDLANDREDLANDSREDMONDREDROCKREDSTONE ARSNL HUNTSVILLEREDWOOD FALLSREED CITYREEDER REEDLEYREEDSBURGREEDSPORTREEDSVILLEREEDVILLEREELSVILLEREFORMREFUGIOREGANREHOBOTHREIDSVILLEREIDVILLEREKLAWREMERREMINGTONREMSENREMSENBURGREN FREWRENORENSSELAERRENSSELAERVILLERENTONREPUBLICRESERVERESTONREVENNAREVEREREVILLOREXBURGREXFORDREYNOLDSRHAMERHINEBECKRHINELANDERRHOADESVILLERHOMERICERICE LAKERICEBORORICHARD SPRINGSRICHARDSONRICHARDTONRICHEYRICHFIELDRICHFIELD SPRINGSRICHLANDRICHLAND CENTERRICHLAND SPRINGSRICHLANDSRICHMONDRICHMOND / ASHLANDRICHTONRICHVALERICHWOODRICORIDGERIDGECRESTRIDGEFIELD PARKRIDGELANDRIDGELYRIDGEVIEWRIDGEWAYRIDGWAYRIDLEY PARKRIESELRIFLERIGBYRIGGINSRILEYRIMROCKRINGGOLDRINGOESRINGSTEDRIORIO BLANCORIO CREEKRIO GRANDERIO ГРАНДЕ CITYRIO HONDORIO LINDARIO RANCHORIO VISTARIPLEYRIPONRISING STARRISING SUNRITARITZVILLERIVER БЕНД LODGERIVER FALLSRIVER RANCHRIVERDALERIVERHEADRIVERSIDERIVERSIDE / Rubidoux / RIVERTONRIVERVIEWRIVIERE-DU-LOUPRIXEYVILLEROACHDALEROADTOWNROANOKEROANOKE RAPIDSROARING SPRINGROBAROBBINSROBBINSDALEROBBINSVILLEROBERTROBERTAROBERTSROBERTSDALEROBINSONROBINSONVIL LEROBSTOWNROCAROCHDALEROCHE HARBORROCHELLEROCHESTERROCKROCK CITYROCK CREEKROCK HILLROCK ISLANDROCK RAPIDSROCK SOUNDROCK SPRINGSROCK VALLEYROCKDALEROCKFORDROCKINGHAMROCKLANDROCKLEDGEROCKPORTROCKSPRINGSROCKTONROCKTON / BELVIDEREROCKVILLEROCKWALLROCKWELL CITYROCKWOODROCKY FORDROCKY HILLROCKY MOUNTROCKY RIDGERODANTHERODEOROGERSROGERS CITYROGERSVILLEROGGENROGUE RIVERROI-NAMURROLANDROLETTEROLLAROLLA / VICHYROLLING FORKROLLING MEADOWSROLLING PRAIRIEROLLINSFORDROMAYORROMEROMEOROMNEYROMOLANDRONANRONCEVERTEROOPVILLEROOSEVELTROPESVILLEROSALIAROSAMONDROSANKYROSARIOROSCOEROSCOMMONROSE BUDROSE HILLROSEAUROSEBOROROSEBUDROSEBURGROSELANDROSELLEROSEMARKROSEMEADROSEMONTROSENBERGROSEVILLEROSHARONROSICLAREROSS RIVERROSSTONROSSVILLEROSWELLROTA ISLANDROTAN / ROBYROUGH И READYROULETTEROUND LAKEROUND MOUNTAINROUND ROCKROUNDUPROUSES POINTROUYN-NORANDAROWEROWLANDROWLETTROWLEYROXANAROXBOROROXBURYROYROYALROYAL CITYROYAL OAKROYALTONROYSE CITYROZETRUBYRUBY VALLEYRUCHRUFFINRUGBYRUIDOSARUIDOSORUMFORDRUMSEYRUPERTRUSHRUSH С ITYRUSH SPRINGSRUSHFORDRUSHVILLERUSSELLRUSSELL SPRINGSRUSSELLVILLERUSSIAN FLATRUSSIAN MISSIONRUSTBURGRUSTONRUTHRUTHERFORDRUTHERFORDTONRUTLANDRUTLEDGERYERYEGATESABATTUSSABETHASABINSABINALSABINE PASSSABINSVILLESABOTSAC CITYSACOSACRAMENTOSADLERSAFETY HARBORSAFFORDSAGAPONACKSAGESAGINAWSAGINAW BAYSAGLESAGUACHESAINT CHARLESSAINT CLOUDSAINT JOHNSAINT LOUISSAINT ROBERTSAIPAN ISLANDSALADOSALEMSALEMBURGSALIDASALINASALINASSALINESALISBURYSALIXSALLISAWSALMONSALMON LAKESALOMESALT FLATSALT LAKE CITYSALTON CITYSALUDASALVISASAMSONSAMSULASAN ANDREASSAN ANGELOSAN ANTONIOSAN ARDOSAN AUGUSTINESAN BENITOSAN BERNARDINOSAN BUENAVENTURASAN CARLOSSAN CLEMENTESAN CLEMENTE ISLANDSAN ДиегоСан DIEGO / EL CAJONSAN DIMASSAN FERNANDOSAN FRANCISCOSAN GERMANSAN JOAQUINSAN JOSESAN JOSE TINIANSAN ХОСЕ, TINIANSAN JUANSAN LEONSAN LORENZOSAN LUISSAN LUIS OBISPOSAN MANUELSAN MARCOSSAN MARTINSAN MATEOSAN NICOLAS ISLANDSAN PEDROSAN RAFAELSAN RAFELSAN ROQUESAN SABASAN SIMEONSAN YGNACIOSANATOGASANBORNTONSAND COULEES RINGSSANDERSONSANDERSVILLESANDIASANDPOINTSANDSPITSANDSPRINGSSANDSTONESANDUSKYSANDWICHSANDYSANDY POINTSANDY SPRINGSSANDY VALLEYSANFORDSANGERSANGERVILLESANIBELSANTA ANASANTA BARBARASANTA CLARASANTA CRUZSANTA ELENASANTA FESANTA MARGARITASANTA MARIASANTA MONICASANTA PAULASANTA ROSASANTA TERESASANTA YNEZSANTA YSABELSANTE FESANTIAM JUNCTIONSANTOSAPULPASARANACSARANAC LAKESARASOTASARASOTA / BRADENTONSARATOGASARATOGA SPRINGSSARBENSARDINIASARGENTSARLESSARNIASASAKWASASSAMANSVILLESATANTASATSUMASAUGERTIESSAUGUSSAUK CENTRESAULT СТЭ MARIESAUSALITOSAVAGETONSAVANNASAVANNAHSAVOONGASAWYERSAWYERVILLESAXONSAYRESAYREVILLESCAMMON BAYSCANDINAVIASCAPPOOSESCARBOROUGHSCENERY HILLSCENICSCHAFERSCHELLVILLE / SONOMASCHENECTADYSCHENEVUSSCHOOLCRAFTSCHROON LAKESCHUYLERVILLESCHYLERSCIOSCOBEYSCOOBASCOTLANDSCOTLAND NECKSCOTTSCOTT CITYSCOTTSBLUFFSCOTTSBOROSCOTTSBURGSCOTTSDALESCOTTSMOORSCOTTSVILLESCRANTONSCRIBNERSCURRYSEABOARDSEABROOKSEADRIFTSEAFORDSEAFORTHSEAGOVILLESEAGRAVESSEALYSEAMANSEARCHLIGHTSEARCYSEARLESSEARSMONTSEASIDESE ATTLESEBASTIANSEBEWAINGSEBRINGSECAUCUSSECORSEDALIASEDANSEDGWICKSEDONASEDRO WOOLLEYSEELEY LAKESEGUINSEILINGSEKIUSELAHSELAWIKSELBYSELDENSELDOVIASELIGMANSELINSGROVESELLSSELMASELMERSEMINARYSEMINOLESEMMESSENECASENECA FALLSSENOIASEQUIMSERENASEVERANCESEVERYSEVIERVILLESEWALL’S POINTSEWANEESEWARDSEYMOURSHADY COVESHADY SHORESSHAFTERSHAGELUKSHAKOPEESHAKTOOLIKSHALLOWATERSHAMOKINSHAMROCKSHANDONSHANIKOSHANNONSHARONSHARON CENTERSHARON SPRINGSSHARONVILLESHARPS CHAPELSHARPSBURGSHARPSVILLESHARTLESVILLESHATTUCKSHAUCKSHAVER LAKESHAWSHAW ISLANDSHAWANOSHAWMUTSHAWNEESHEAKEYVILLESHEARERSHEBOYGANSHEEP MOUNTAINSHEFFIELDSHELBURNESHELBYSHELBYVILLESHELDONSHELL KNOBSHELL LAKESHELLMAN BLUFFSHELTER COVESHELTER ISLANDSHELTONSHEMYASHENANDOAHSHEPHERDSHEPHERDSVILLESHERBORNSHERBROOKESHERBURNESHERIDANSHERMANSHERMAN OAKSSHERMAN / DENISONSHERMANS DALESHERMANSDALESHERRARDSHERRILLSHERRILLS FORDSHEYENNESHILOHSHINERSHINNSTONSHIOCTONSHIPPENSBURGSHIPROCKSHIPSHEWANASHIRLANDSHIRLEYSHISHMAREFSHOEMAKERSVILLESHOMU-SHONSHOREHAMSHOREVIEWSH ORTERSHOSHONESHOSHONISHOW LOWSHREVESHREVEPORTSHREWSBURYSHUBERTSHUNGNAKSHUQUALAKSIBLEYSIDELLSIDNAWSIDNEYSIERRA VISTASIERRAVILLESIGELSIGOURNEYSIKESTONSILER CITYSILETZSILEXSILOAM SPRINGSSILTSILVER BAYSILVER CITYSILVER LAKESILVER SPRINGSSILVERDALESILVERTONSILVISSIMI VALLEYSIMLASIMMESPORTSIMPSONVILLESIMSBURYSINCLAIRSINTONSIOUX CENTERSIOUX CITYSIOUX FALLSSIRENSISSETONSISTERDALESISTERSSITKASIX MILESIXESSKAGWAYSKAMANIASKAMOKAWASKANEATELESSKELLYTOWNSKIATOOKSKIPPACKSKOWHEGANSKULL VALLEYSKWENTNASKYKOMISHSLADENSLADESVILLESLANASLATE CREEKSLATE HILLSLATINGTONSLATONSLAUGHTERSLAYTONSLEEPY EYESLEETMUTESLICKPOOSLIDELLSLOCOMBSMICKSBURGSMILEY CREEKSMITHSMITH CENTERSMITH POINTSMITH VALLEYSMITHERSSMITHFIELDSMITHS ПАДАЕТ-MONTAGUESMITH’S FERRYSMITHS STATIONSMITHVILLESMOKETOWNSMYRNASNEEDVILLESNELLINGSNELLVILLESNETTISHAMSNOHOMISHSNOOKSNOWBALLSNOWSHOESNYDERSO SIOUX CITYSOCIAL CIRCLESOCORROSODA SPRINGSSOLDIER BARSOLDIERS GROVESOLDOTNASOLEBURYSOLEDADSOLOMONSOLONSOLON SPRINGSSOMERSSOMERS POINTSOMERSETSOMERTONSOMERVI LLESOMONAUKSONOITASONOMASONORASOPERTONSOUDERTONSOUR LAKESOURISSOUTH BAYSOUTH BELOITSOUTH BENDSOUTH БЕНД / РАЙМОНД / ЮЖНЫЙ BETHLEHEMSOUTH BIMINISOUTH BOSTONSOUTH BRUNSWICKSOUTH BURLINGTONSOUTH CAIROSOUTH CHARLESTONSOUTH COFFEYVILLESOUTH DAYTONSOUTH DAYTONASOUTH ELGINSOUTH FORKSOUTH GLASTONBURYSOUTH HAVENSOUTH HEROSOUTH HILLSOUTH HOUSTONSOUTH HUTCHINSONSOUTH JORDANSOUTH KENNERSOUTH KORTRIGHTSOUTH ЛАГУНА BEACHSOUTH ОЗЕРО TAHOESOUTH LINCOLNSOUTH LYONSOUTH NAKNEKSOUTH PADRE ISLANDSOUTH PRAIRIESOUTH RENOVOSOUTH ROCKWOODSOUTH SALT LAKE CITYSOUTH ST PAULSOUTH WALESSOUTH WILLIAMSONSOUTH WINDSORSOUTH WOODSTOCKSOUTHAMPTONSOUTHBOROUGHSOUTHBRIDGESOUTHFIELDSOUTHOLDSOUTHPORTSOUTHWICKSPALDINGSPANAWAYSPANGLESPANISH FORKSPANISH FORTSPARKSSPARLANDSPARREVOHNSPARTASPARTANBURGSPARTANSBURGSPEARFISHSPEARMANSPEEDWAYSPENCEPORTSPENCERSPENCERPORTSPENCERVILLESPERRYSPICEWOODSPIRIT LAKESPOFFORDSPOKANESPOONERSPOTTED BEARSPRAGUESPRAGUE RIVERSPRINGSPRING BRANCHSPRING CITYSPRING GROVESPRING HILLSPRING HOPESPRING LAKESPRING M ILLSSPRING POINTSPRING PRAIRIESPRING VALLEYSPRINGBROOKSPRINGDALESPRINGERSPRINGERVILLESPRINGFIELDSPRINGFIELD / CHICOPEESPRINGFIELD / JASPERSPRINGHILLSPRINGPORTSPRINGTOWNSPRINGVILLESPRUCE PINESPURSQUAW HARBORST ANTHONYST AUGUSTINEST BERNARDST CATHARINESST CHARLESST CLAIRST CLAIRSVILLEST CLOUDST КРУА FALLSST DavidST ELMOST FRANCISST FRANCISVILLEST GABRIELST GENEVIEVEST GEORGEST GEORGESST GERMAINST HELENST HELENAST IGNACEST IGNATIUSST INIGOESST JACOBST JAMESST JEANST JOHNST JOHNSST JOHN’SST JOSEPHST LEONARDST LOUISST MARIESST MARYSST MARY’SST МЭТЬЮССТ МАЙКЛСТ МАЙКЛССТ ПАРИЗСТ ПАУЛСТ ПАУЛ ОСТРОВ ПОЛ ПАРКСТ ПЕТЕРССТ ПЕТЕРБУРГСТ ПЕТЕРБУРГ-КЛИРУОТЕРСТ САЙМОНС ОСТРОВ ТОМАССТ ВЕНДЕЛЬСТ.АВГУСТИНЕСТ. КЛЕРСТ. ДЖЕЙМССТ. ДЖОНССТ. ИОЗЕФСТ. ЛУИСТ. МАРТИНСТ. МЭРИССТ. МЭРИ МЭТЬЮССТ. ПАУЛЬСТ. ПОЛССТ. САНКТ-ПЕТЕРБУРГСТ. WENDELSTAATSBURGSTAFFORDSTAHLSTOWNSTAMFORDSTANDISHSTANFIELDSTANFORDSTANIEL CAYSTANLEYSTANTONSTANWOODSTAPLESSTAPLETONSTARSTAR CITYSTAR PRAIRIESTARBUCKSTARKEYSTARKVILLESTARKWEATHERSTARLIGHTSTARTUPSTARTZVILLESTATE COLLEGESTATEN ISLANDSTATESBOROSTATESVILLESTAUNTONSTAUNTON / WAYNESBORO / HARRISONBURGSTAYTONSTE GENEVIEVESTEAM БОТ SPRINGSSTEAMBOAT BAYSTEAMBOAT SPRINGSSTEBBINSSTEELESTEELES TAVERNSTEELTONSTEHEKINSTEILACOOMSTEINAUERSTEINERSTEINHATCHEESTELLA MARISSTEPHENSTEPHENSSTEPHENVILLESTERLINGSTERLING CITYSTERLING / ROCKFALLSSTEUBENSTEUBENVILLESTEVENS POINTSTEVENS VILLAGESTEVENSONSTEVENSVILLESTEWARDSTEWARTSTEWARTSTOWNSTIGLERSTILESSTILL PONDSTILLMAN VALLEYSTILLMAN желобок (БАЙРОН) STILLWATERSTILWELLSTITESSTOCKBRIDGESTOCKDALESTOCKHOLMSTOCKPORTSTOCKTONSTOCKWELLSTONE CHURCHSTONE LAKESTONE MOUNTAINSTONE RIDGESTONEHAMSTONEWALLSTONINGTONSTONY BROOKSTONY POINTSTONY RIVERSTORM LAKESTORMVILLESTOUGHTONSTOVERSTOWSTOYSTOWNSTRAFFORDSTRANDBURGSTRASBURGSTRATFORDSTRATHMORESTRATTANVILLESTREATORSTREETERSTROHSTRONGSTOW NSTROUDSTROUDSBURGSTRUMSTRYKERSVILLESTUARTSTUART ISLANDSTUGISSTURGEON BAYSTURGISSTURTEVANTSTUTTGARTSUBLETTESUCHESSUDANSUDBURYSUDLERSVILLESUFFERNSUFFOLKSUGAR GROVESUGAR LANDSUGARLANDSULLIVANSULLIVANVILLESULLYSULPHURSULPHUR SPRINGSSUMASSUMMERDALESUMMERLAND KEYSUMMERSIDESUMMERSVILLESUMMERTONSUMMERVILLESUMMITSUMMUMSUMNERSUMTERSUN CITYSUN ГОРОД WESTSUN VALLEYSUNBURYSUNDANCESUNFIELDSUNFLOWERSUNLANDSUNNILANDSUNNYSIDESUNNYVALESUNRAYSUNRISESUNRISE BEACHSUNRISE BEACH VILLAGESUNRIVERSUNSETSUPAI VILLAGESUPERIORSUPPLYSURINGSURPRISESURRYSUSANVILLESUSITNA STATIONSUSQUEHANNASUSSEXSUTHERLANDSUTHERLINSUTTONSWAINSBOROSWANS ISLANDSWANSBOROSWANTONSWARTZ CREEKSWEDENSWEETGRASSSWEETWATERSWINKSYCAMORESYLACAUGASYLMARSYLVASYLVAN GROVESYLVANIASYLVESTERSYLVIASYRACUSETABLE GROVETABOR CITYTABSCOTTTACOMATAFTTAHLEQUAHTAHOKATAKOMA PARKTAKOTNATAKU HARBORTAKU LODGETALALATALBOTTONTALIHINATALKEETNATALLADEGATALLAHASSETALLAHASSEETALLAHASSEE / HAVANA / TALLASSEETALLULAHTALMOTAMATAMAQUATAMARACTAMMSTAMPATANACROSSTANANATANEYTOWNTANG IERTANNERSVILLETAORA IS Малоэлап ATOLLTAOSTAPPAHANNOCKTAPPENTARBOROTARKIOTARLTONTARPON SPRINGSTARRYALLTATITLEKTATITNATATUMTAUNTONTAVARESTAVERNIERTAYLORTAYLOR ГОРА MINETAYLORS FALLSTAYLORSVILLETAYLORVILLETAZEWELLTAZLINATCHULATEATEAGUETECUMSEHTEHACHAPITEKAMAHTEKOATELFORDTELIDATELL CITYTELLERTELLICO PLAINSTELLURIDETEMECULATEMPETEMPLETEMPLE BARTEMPLETONTEN SLEEPTENAKEE SPRINGSTENDALTENINOTENNANTTENNESSEE COLONYTENNEYTENNGATERLINGUATERLINGUA / ALPINE / TERN ISLANDTERRA ALTATERRACETERRE HAUTETERRELLTERRYTESLINTETERBOROTETLINTEWKSBURYTEXARKANATEXAS CITYTEXAS CREEKTEXHOMATEXLINETHACKERVILLETHATCHERTHAYERTHAYNETHE DALLESTHE GROVE / RANCHTHE SEA RANCHTHE VALLEYTHE VILLAGESTHE WOODLANDSTHEDFORDTHEINSVILLETHEODORETHEODOSIATHERIOTTHERMALTHERMOPOLISTHIBODAUXTHIEF RIVER FALLSTHOMASTHOMASBOROTHOMASTONTHOMASVILLETHOMPSONTHOMPSON FALLSTHOMPSONVILLETHOMSONTHORNE BAYTHORNTONTHORNVILLETHORNWELLTHORPTHOUSAND OAKSTHREE CREEKTHREE FORKSTHREE LAKESTHREE OAKSTHREE RIVERSTHREE SPRINGSTHROCKMORTONTHUNDER BAYTHURB ERTHURMONTTIBER DAMTICONDEROGATIDIOUTETIFFINTIFTONTIGARDTIKCHIKTILDENTILGHMANTILLAMOOKTILLARTIMBER LAKETIMEWELLTIMMINSTIMMONSVILLETIN CITYTINIAN ISLANDTINICUMTINTAHTINTON FALLSTIOGATIPP CITYTIPTONTIPTONVILLETIRATISHOMINGOTISKILWATITUSVILLETIVERTONTOA ALTATOBYHANNATOCCOATOCSINTOFINOTOGIAK VILLAGETOKTOKEENTOKSOOK BAYTOLARTOLEDOTOLLESONTOLNATOLSONA LAKETOM BEANTOMAHTOMAHAWKTOMBALLTOMBSTONETOMPKINSVILLETOMS RIVERTONASKETTONOPAHTOOELETOOELE CITYTOOLIK ПОЛЕ STATIONTOONETOPEKATOPINABEETOQUERVILLETORONTOTORRANCETORRINGTONTOTATLANIKA RIVERTOTOWATOUCHETTOUGHKENAMONTOULONTOWACOTOWANDATOWERTOWER CITYTOWN И COUNTRYTOWNERTOWNSENDTOWNSHENDTOWSONTOYAHVALETRACYTRADING BAYTRAERTRANSFERTRANSYLVANIATRAPPER CREEKTRAPPER ЗАВОДЬ / TALKEETNATRAVELERS RESTTRAVERSE CITYTREADWELLTREASURE CAYTREMONT CITYTREMONTONTRENTONTRESKOWTRIANGLETRIBUNETRIDELLTRIMBLETRINIDADTRINITYTRINITY CENTERTRIVOLITROIS-RIVIERESTRONATROPICTROSKYTROUPTROUT CREEKTROUT LAKETROUT RUNTROYTRUCKEETRUMANTRUMBAUERSVILLETRUMBULLTRUSCOTTTRUTH ИЛИ СО NSEQUENCESTRYONTUALATINTUBA CITYTUCSONTUCUMCARITUFTONBOROTUKWILATULARETULAROSATULELAKETULIATULLAHOMATULSATULUKSAKTUM TUMTUNICATUNKHANNOCKTUNNEL HILLTUNTUTULIAKTUNUNAKTUPELOTURBEVILLETURBOTVILLETURLOCKTURNERTURRELLTURTLE LAKETUSAYANTUSCALOOSATUSCARORATUSCOLATUSCUMBIATUSKEGEETUTTLETUTWILERTUXEKAN ISLANDTWENTYNINE PALMSTWIN BRIDGESTWIN BROOKSTWIN FALLSTWIN HILLSTWIN MOUNTAINTWIN SISTERSTWINSBURGTWISPTWO BUTTESTWO HARBORSTWO RIVERSTYLERTYLERSBURGTYLERTOWNTYNDALLTYNGSBOROTYONE CREEKTYONEKTYRONEUDALLUGASHIKUKIAHULITHIULLINULMULSTERULYSSESUMATILLAUMIATUNADILLAUNALAKLEETUNALASKAUNDERWOODUNIONUNION BEACHUNION CITYUNION DALEUNION GROVEUNION HALLUNION HILLUNION MILLSUNION SPRINGSUNIONDALEUNIONTOWNUNIONVILLEUNISONUNIVERSALUNIVERSAL CITYUPHAMUPLANDUPPER LAKEUPPER Merion TOWNSHIPUPPER SANDUSKYUPPER STRASBURGUPPERVILLEUPTONURANIAURBANAURBANNAUTICAUTICA / FRANKFORTUTIRIK ISLANDUTOPIAUTOPIA CREEKUTQIAGVIKUVALDEVACAVILLEVAIDENVAILVALDESEVALDEZVAL-D’ORVALDOSTAVALEVALENCIAVALENTINEVALHALLAVALIERVALKARIAVALL EYVALLEY CENTERVALLEY CITYVALLEY MILLSVALLEY POINTVALLEY SPRINGSVALLEY VIEWVALMEYERVALPARAISOVALPARAISO / ДЕСТИН-FT УОЛТОН BEACHVANVAN ALSTYNEVAN BURENVAN DYNEVAN HORNVAN NUYSVAN WERTVANCEVANCOUVERVANDALIAVANDERGRIFTVARNVILLEVASHONVASSALBOROVASSARVAUGHNVEEDERSBURGVEGAVEGA BAJAVELMAVELVAVENANGOVENETIEVENICEVENTURAVENUSVERAVERDIGREVERGENNESVERMILIONVERMILLIONVERMONTVILLEVERNALVERNONVERNONIAVERO BEACHVERONAVERRETVERSAILLESVESTAVEVAYVIBORGVIBURNUMVICIVICKERYVICKSBURGVICTORVICTORIAVICTORVILLEVICTORY БИБЛИЯ CAMPVIDALIAVIDORVIENNAVILLA GROVEVILLA RICAVILLA RIDGEVILLAGE MILLSVILLE PLATTEVILONIAVINAVINALHAVENVINCENNESVINCENTVINCENTOWNVINE GROVEVINELANDVINEYARD HAVENVINITAVINTAVINTONVIOLAVIRDENVIRGINVIRGINIAVIRGINIA BEACHVIROQUAVISALIAVIVIANVOLANTVOLCANO VILLAGEVOLUNTOWNVON ORMYVONOREVOORHEESWABASHWABASHAWACOWACONIAWADENAWADESBOROWADLEYWADSWORTHWAGNERWAGONERWAHIAWAWAHOOWAHPETONWAIKOLOA VILLAGEWAILUKUWAINWRIGHTWAITSBURGWAITSFIELDWAKARUSAWAKE ISLANDWAKEENEYWAKEFIELDWAKEMANWAKENDAWAKONDAWALBRIDGEWALCO TTWALDENWALDPORTWALDRONWALESWALES ЦЕНТР / COWLESVILLE / WALFORDWALHALLAWALKERWALKERTONWALLWALLA WALLAWALLACEWALLERWALLINGFORDWALLISWALLISVILLEWALLKILLWALLOPS ISLANDWALLOWAWALLSWALNUTWALNUT COVEWALNUT CREEKWALNUT GROVEWALNUT HILLWALNUT RIDGEWALNUT SPRINGSWALPOLEWALSENBURGWALSHWALTERBOROWALTERSWALTHAMWALTONWALWORTHWAMEGOWAMICWAMPUMWANBLEEWANETTEWAPAKONETAWAPATOWAPELLAWAPINITIAWARDENWAREWAREHAMWAREHOUSE POINTWARINGWARM SPRINGSWARMINSTERWARNER ROBINSWARNER SPRINGSWARRENWARRENSBURGWARRENSVILLE HEIGHTSWARRENTONWARRENVILLEWARROADWARSAWWARWICKWASCOWASECAWASHBURNWASHINGTONWASHINGTON СУД HOUSEWASHINGTON ISLANDWASHINGTON TERRACEWASHINGTON TWPWASHINGTONVILLEWASHOUGALWASHTUCNAWASILLAWASKISHWASKOMWATER VALLEYWATERBORO CENTERWATERBURYWATERFALLWATERFORDWATERLOOWATERMANWATERPROOFWATERSMEETWATERTONWATERTOWNWATERVILLEWATERVLIETWATFORD CITYWATKINSWATKINS GLENWATONGAWATSEKAWATSONWATSON LAKEWATSONTOWNWATSONVILLEWAUBUNWAUCHULAWAUKEGANWAUKESHAWAUKONWAUNAKEEWAUPACAWAUPUNWAUSAWAUSAUWAUSAUKEEWAUSEONWAUTOMAWAUWATO SAWAVERLYWAVERLY HALLWAXAHACHIEWAXHAWWAYCROSSWAYLANDWAYNEWAYNESBOROWAYNESBURGWAYNESVILLEWAYNOKAWAYSIDEWAYZATAWEATHERFORDWEATHERLYWEAVERVILLEWEBBERVILLEWEBSTERWEBSTER CITYWEDDINGTONWEDOWEEWEEDWEEDSPORTWEEHAWKENWEEPING WATERWEIDMANWEIMARWEINERWEIPPEWEIRSDALEWEIRTONWEIRWOODWEISERWELAKAWELCHWELCOMEWELDWELLINGTONWELLSWELLSBOROWELLSBURGWELLSTONWELLSVILLEWELLTONWELSHWEMERSVILLEWENATCHEEWENDELLWENDENWENDOVERWENO ISLANDWENONAWENTWORTHWENTZVILLEWESLACOWESLEYWESLEY CHAPELWESSINGTON SPRINGSWEST FRANKFORTWEST ALEXANDRIAWEST ALTONWEST BATHWEST BAYWEST BENDWEST BLOOMFIELDWEST BRANCHWEST BROOKFIELDWEST BROOKLYNWEST BURKEWEST BURLINGTONWEST CHESTERWEST COLUMBIAWEST COXSACKIEWEST CREEKWEST DOVERWEST EPPINGWEST FARGOWEST GLACIERWEST GROVEWEST HARTFORDWEST HOLLYWOODWEST ISLIPWEST JEFFERSONWEST JORDANWEST KILLWEST KINGSTONWEST LAFAYETTEWEST LEBANONWEST LIBERTYWEST LINNWEST LONG BRANCHWEST LOS ANGELESWEST MELBOURNEWEST MEMPHISWEST MIDDLESEXWEST MILFORDWEST MILTONWEST MONROEWEST NEWBURYWEST OSSIPEEWEST PALM BEACHWEST PAWLETTWEST PLAINSWEST POINTWEST READINGWEST SACRAMENTOWEST SOUNDWEST SPRINGFIELDWEST UNIONWEST желобок Citywest YELLOWSTONEWESTBROOKWESTCLIFFEWESTERLYWESTERVELTWESTERVILLEWESTFIELDWESTFIELD CENTERWESTFIELD / SPRINGFIELDWESTFORDWESTHAMPTON BEACHWESTHOPEWESTLAKEWESTLEYWESTLINEWESTMINSTERWESTMINSTER / СЕРЕБРО RUNWESTMORELANDWESTONWESTOVERWESTPHALIAWESTPORTWETUMKAWETUMPKAWEXFORDWEYBRIDGEWHALE PASSWHALEYVILLEWHARTONWHARTONVILLEWHEAT RIDGEWHEATFIELDWHEATLANDWHEATONWHEELERWHEELINGWHITAKERSWHITEWHITE МЕДВЕДЬ TOWNSHIPWHITE CityWhite CLOUDWHITE CREEKWHITE HALLWHITE HAVENWHITE HILLSWHITE LAKEWHITE MOUNTAINWHITE OAKWHITE PLAINSWHITE POSTWHITE RIVERWHITE SALMONWHITE STONEWHITE СЕРЫ SPRINGSWHITE SWANWHITEFIELDWHITEFISHWHITEHALLWHITEHORSEWHITEHOUSE STATIONWHITELAWWHITERIVERWHITESBOROWHITESBURGWHITESTONEWHITEVILLEWHITEWATERWHITINGWHITLEY GARDENWHITMOREWHITMORE LAKEWHITNEYWHITTWHITTEMOREWHITTIERWHITWELLWIARTONWICHITAWICHITA FALLSWICHITA / MAIZE / WICKENBURGWICONISCOWIERGATEWIGGINSWILBRAHAMWILBURWILBU RTONWILD ROSEWILDOMARWILDORADOWILDWOODWILKES BARREWILKES-BARREWILKES-Барре / SCRANTONWILKESONWILLAMINAWILLARDWILLCOXWILLIAMSWILLIAMSBURGWILLIAMSFIELDWILLIAMSONWILLIAMSON / SODUSWILLIAMSPORTWILLIAMSTONWILLIAMSTOWNWILLIAMSVILLEWILLIMANTICWILLINGBOROWILLISWILLISTONWILLISTOWNWILLITSWILLMARWILLOUGHBYWILLOWWILLOW CITYWILLOW PARKWILLOW SPRINGSWILLOWBROOKWILLOWSWILLS POINTWILLSHIREWILMERWILMINGTONWILMOTWILSALLWILSONWILSON CREEKWILSONVILLEWILTONWIMAUMAWIMBERLEYWIMBERLYWINAMACWINCHESTERWIND GAPWINDERWINDERMEREWINDHAMWINDOMWINDOW ROCKWINDSORWINDSOR LOCKSWINFALLWINFIELDWINFIELD / АРКАНЗАС CITYWINFILEDWINFREDWINGATEWINIFREDWINKWINLOCKWINNWINNABOWWINNECONNEWINNEMUCCAWINNERWINNETTWINNFIELDWINNIEWINNIE / STOWELLWINNSBOROWINONAWINONA LAKEWINSLOWWINSLOW TOWNSHIPWINSTEDWINSTON SALEMWINSTON-SALEMWINTER BEACHWINTER GARDENWINTER HAVENWINTER SPRINGSWINTERSWINTERSBURGWINTERSETWINTERSTOWNWINTERSVILLEWINTERVILLEWINTHROPWIOTAWISCASSETWISCONSIN DELLSWISCONSIN RAPIDSWISDOMWISEWISE RIVERWISEMANWISHEKWITHAMSWOBURNWOLCOTTWOL F CREEKWOLF LAKEWOLF POINTWOLFE CITYWOLFEBOROWOLFFORTHWOLFLAKEWOLFSVILLEWOLVERTONWONDERWONEWOCWOODBINEWOODBURNWOODBURYWOODCOCKWOODGLENWOODINVILLEWOODLAKEWOODLANDWOODLAND HILLSWOODLAND PARKWOODRUFFWOODSFIELDWOODSONWOODSTOCKWOODSTOWNWOODSVILLEWOODVILLEWOODWARDWOODWORTHWOOLCOTTVILLEWOOLSEYWOOLWINEWOONSOCKETWOOSTERWORCESTERWORLANDWORLEYWORMLEYSBURGWORTHINGTONWORTHINGTON SPRINGSWORTONWOTJE ATOLLWRANGELLWRAYWRENSWRIGHTSTOWNWRIGHTSVILLEWURTSBOROWYANDOTTEWYLIEWYMOREWYNANTSKILLWYNDMEREWYNNEWYOCENAWYOMINGWYSOXWYTHEVILLEXENIAYADKINVILLEYAKATAGAYAKIMAYAKUTATYALEYALESVILLEYAMHILLYANCEYVILLEYANKEE CREEKYANKTONYANTISYAP ISLANDYARMOUTHYATES CITYYAZOO CITYYEEHAW JUNCTIONYELLOW PINEYELLOW SPRINGSYELLVILLEYELMYERINGTONYERMOYES BAYYIGOYOAKUMYODERYOKENAYORKYORK SPRINGSYORKTOWNYORKVILLEYOUNGYOUNGSTOWNYOUNGSTOWN / WARRENYOUNGSVILLEYPSILANTIYUBA CITYYUCCAYUCCA VALLEYYUKON Charley RIVERSYULEEYUMAYUMA полигоном (ЮМА) ZACHARYZALMAZANESVILLEZAPATAZEBULONZEELANDZELIENOPLEZELLWOODZENIAZEPHYRHILLSZIEGLERVILLEZILLA HZIONZIONSVILLEZIRCONIAZOARZOLFO SPRINGSZORTMANZUNIZWINGLEZWOLLE

Использование объекта: ВСЕ ОБЪЕКТЫОБЩЕСТВЕННОЕ ИСПОЛЬЗОВАНИЕ

Часть 139 Сертификация: ВСЕ ОБЪЕКТЫ СЕРТИФИЦИРОВАНЫ НЕ СЕРТИФИЦИРОВАНЫ

  • Чтобы просмотреть все местоположения, нажмите кнопку Отправить , не делая выбора.
  • Название города или округа может существовать более чем в одном штате. Если вы выбираете город или округ, вы также должны выбрать штат, чтобы избежать дублирования.
  • Если вы не уверены, какой регион или район выбрать, перейдите к контактной информации штаб-квартиры FAA и региональных офисов аэропортов связанных штатов.

Инструмент импорта данных аэропорта

Следующий инструмент преобразует данные аэропортов, доступные в Службе аэронавигационной информации FAA, 28-дневная подписка NASR, в те же таблицы, которые использовались в качестве источника для этого сайта.

К началу

Словари данных аэропорта

В следующем списке показаны имена и описания полей для четырех таблиц, содержащих данные аэропорта.

К началу

Другие сайты данных аэропортов FAA

К началу

Соответствующие формы FAA

К началу

К началу

Последнее изменение страницы:

Внешний тюнинг «Калина» -универсал

За все время своего существования «Лада-Калина» заслужила множество сторонников.Этот автомобиль очень популярен в России и Украине. Причем покупают его не только молодежь, но и пенсионеры. Столь широкому спросу способствовал довольно красивый дизайн автомобиля, уже не напоминавший водителям об их российской строгости и прямоугольности. Однако некоторые мастера находят способы улучшить аэродинамические характеристики этого автомобиля и придать ему более спортивный вид. В сегодняшней статье мы рассмотрим, как производится внешняя настройка.

«Калина» -универсал (фото стайлинга вы видите выше) — автомобиль, который очень часто «украшают» сами хозяева.И первое, с чего лучше начать работу, это с замены стандартных дисков. Простая штамповка не придает автомобилю грозного вида. А если хотите сделать «Калину» более мужественной и спортивной, установите на нее легкосплавные диски. Благо, ассортимент таких товаров на сегодняшний день очень большой, и подобрать нужную вещь не составляет особого труда. Однако настоящая проблема выбора — это диаметр колесных дисков. Чаще всего автомобилисты не рискуют, не экспериментируют с размерами и устанавливают 14-дюймовые колеса.Конечно, есть варианты и с большими значениями, но вряд ли они улучшат характеристики маневренности. Дело в том, что даже 15-дюймовые колеса затрудняют вход машины в повороты. Поэтому лучший вариант — выбрать колесо стандартных размеров.

Тюнинг «Калина» -универсал не обходится без установки пластиковых «примочки». Например, дизайн дополнят новые спойлеры и бамперы. Также как вариант можно купить крыло. Внешний тюнинг «Калина» -универсал обязательно сопровождается установкой верхнего спойлера.Идеальным вариантом станет универсальный вариант модели «Альбатрос». Кстати, это касается только кузова универсал, так как на седан такие вещи не устанавливаются.

Кроме того, вы можете позаботиться о новой оптике. Здесь тюнинг «Калины» -универсал не отличается от своих «сестер» с кузовами хэтчбек и седан. Оптика у всех троих одинаковая. Поэтому в магазине можно не обращать внимания на классификацию моделей. Лучший тюнинг-комплект — это оптика от немецкого производителя Bosch.Эта компания занимается активным производством такой продукции для всех моделей ВАЗ, начиная от «десятки» и заканчивая «Приорой».

Сзади спортивность придадут светодиодные фонари, а спереди можно установить так называемые «ангельские глазки». Также не стоит обходить стороной установку новых противотуманных фар. Стоят они дешево (около тысячи рублей). Но эффект будет завораживающим, особенно если противотуманные фары интегрировать в новый аэродинамический бампер. Такой тюнинг «Калины» -универсал точно не останется без внимания.И в заключение по оптике хочу сказать, что фары «Жигулей» удачно дополнят светодиодные повторители поворотов на боковых зеркалах заднего вида.

Это все были советы по стайлингу отечественного автомобиля «Калина» -универсал. Тюнинг салона — это уже отдельная тема, требующая более детального рассмотрения.

.

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *